KEGG   Nitrosococcus halophilus: Nhal_1364Help
Entry
Nhal_1364         CDS       T01198                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nhal_1364
   01230 Biosynthesis of amino acids
    Nhal_1364
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_1364
  Energy metabolism
   00680 Methane metabolism
    Nhal_1364
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nhal_1364
Enzymes [BR:nhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Nhal_1364
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Nhal_1364
  Exosomal proteins of melanoma cells
   Nhal_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373154..1373888
Genome map
AA seq 244 aa AA seqDB search
MVSRIVLLRHGESVWNLENRFTGWTDVDLSANGIEEARLAGKILKNEGYQFDKAYTSVLK
RAIRTLWIVEEVMDLMWLPIEKRWELNERHYGSLQGLNKAEMAKQYGAELVHQWRRGYAI
EPPPLDDSDPRHPRFDRRYAHLASEKVPASESLEKTLQRVIPCWEKDILPDIAAGKELII
VAHGNSLRALYKHLEGLSDQEVMELNIPTGIPLVFELDEAFRPTAHYYLADSEKGQVAVD
GMAH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtagaatcgttttactgcgtcatggtgaaagcgtatggaatttggaaaatcga
tttacgggctggaccgatgttgatctttctgcaaatggtattgaagaagcccgccttgca
ggcaagatattgaaaaatgaggggtaccaatttgataaggcctacacttcagtgcttaag
cgggccattcgtaccctgtggattgtagaagaagtcatggacttgatgtggcttcccata
gaaaaacggtgggagttgaatgaacgccattatggcagtttacaaggactgaacaaagct
gaaatggccaaacaatatggtgcggagctggtgcatcaatggcgccggggctatgcgatt
gaaccgcctccattggatgattccgatccccgccatccgcgttttgataggcgttatgcc
cacttagcttccgagaaagtcccggcctcggaatcccttgagaagacgcttcagcgggtt
attccctgttgggagaaagatatcttaccggatattgccgcgggcaaggagctgattatt
gtcgcccatggcaattctttgcgggctttatacaagcatcttgaggggttgtccgatcag
gaagtcatggagcttaatatcccgaccggtatccccttggtgtttgaactagatgaggct
ttccggccaaccgcccattattaccttgccgactcggaaaagggtcaggtggctgtcgat
gggatggcccattag

DBGET integrated database retrieval system