KEGG   Nitrosococcus halophilus: Nhal_1364Help
Entry
Nhal_1364         CDS       T01198                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nhal_1364
   01230 Biosynthesis of amino acids
    Nhal_1364
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_1364
  Energy metabolism
   00680 Methane metabolism
    Nhal_1364
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nhal_1364
Enzymes [BR:nhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Nhal_1364
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Nhal_1364
  Exosomal proteins of melanoma cells
   Nhal_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373154..1373888
Genome map
AA seq 244 aa AA seqDB search
MVSRIVLLRHGESVWNLENRFTGWTDVDLSANGIEEARLAGKILKNEGYQFDKAYTSVLK
RAIRTLWIVEEVMDLMWLPIEKRWELNERHYGSLQGLNKAEMAKQYGAELVHQWRRGYAI
EPPPLDDSDPRHPRFDRRYAHLASEKVPASESLEKTLQRVIPCWEKDILPDIAAGKELII
VAHGNSLRALYKHLEGLSDQEVMELNIPTGIPLVFELDEAFRPTAHYYLADSEKGQVAVD
GMAH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtagaatcgttttactgcgtcatggtgaaagcgtatggaatttggaaaatcga
tttacgggctggaccgatgttgatctttctgcaaatggtattgaagaagcccgccttgca
ggcaagatattgaaaaatgaggggtaccaatttgataaggcctacacttcagtgcttaag
cgggccattcgtaccctgtggattgtagaagaagtcatggacttgatgtggcttcccata
gaaaaacggtgggagttgaatgaacgccattatggcagtttacaaggactgaacaaagct
gaaatggccaaacaatatggtgcggagctggtgcatcaatggcgccggggctatgcgatt
gaaccgcctccattggatgattccgatccccgccatccgcgttttgataggcgttatgcc
cacttagcttccgagaaagtcccggcctcggaatcccttgagaagacgcttcagcgggtt
attccctgttgggagaaagatatcttaccggatattgccgcgggcaaggagctgattatt
gtcgcccatggcaattctttgcgggctttatacaagcatcttgaggggttgtccgatcag
gaagtcatggagcttaatatcccgaccggtatccccttggtgtttgaactagatgaggct
ttccggccaaccgcccattattaccttgccgactcggaaaagggtcaggtggctgtcgat
gggatggcccattag

DBGET integrated database retrieval system