KEGG   Nitrosococcus halophilus: Nhal_1364Help
Entry
Nhal_1364         CDS       T01198                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00010  Glycolysis / Gluconeogenesis
nhl00260  Glycine, serine and threonine metabolism
nhl00680  Methane metabolism
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01120  Microbial metabolism in diverse environments
nhl01130  Biosynthesis of antibiotics
nhl01200  Carbon metabolism
nhl01230  Biosynthesis of amino acids
Module
nhl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nhl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_1364
  Energy metabolism
   00680 Methane metabolism
    Nhal_1364
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nhal_1364
Enzymes [BR:nhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Nhal_1364
Membrane trafficking [BR:nhl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Nhal_1364
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Nhal_1364
  Exosomal proteins of melanoma cells
   Nhal_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADE14515
UniProt: D5C0I9
Position
1373154..1373888
Genome map
AA seq 244 aa AA seqDB search
MVSRIVLLRHGESVWNLENRFTGWTDVDLSANGIEEARLAGKILKNEGYQFDKAYTSVLK
RAIRTLWIVEEVMDLMWLPIEKRWELNERHYGSLQGLNKAEMAKQYGAELVHQWRRGYAI
EPPPLDDSDPRHPRFDRRYAHLASEKVPASESLEKTLQRVIPCWEKDILPDIAAGKELII
VAHGNSLRALYKHLEGLSDQEVMELNIPTGIPLVFELDEAFRPTAHYYLADSEKGQVAVD
GMAH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtagaatcgttttactgcgtcatggtgaaagcgtatggaatttggaaaatcga
tttacgggctggaccgatgttgatctttctgcaaatggtattgaagaagcccgccttgca
ggcaagatattgaaaaatgaggggtaccaatttgataaggcctacacttcagtgcttaag
cgggccattcgtaccctgtggattgtagaagaagtcatggacttgatgtggcttcccata
gaaaaacggtgggagttgaatgaacgccattatggcagtttacaaggactgaacaaagct
gaaatggccaaacaatatggtgcggagctggtgcatcaatggcgccggggctatgcgatt
gaaccgcctccattggatgattccgatccccgccatccgcgttttgataggcgttatgcc
cacttagcttccgagaaagtcccggcctcggaatcccttgagaagacgcttcagcgggtt
attccctgttgggagaaagatatcttaccggatattgccgcgggcaaggagctgattatt
gtcgcccatggcaattctttgcgggctttatacaagcatcttgaggggttgtccgatcag
gaagtcatggagcttaatatcccgaccggtatccccttggtgtttgaactagatgaggct
ttccggccaaccgcccattattaccttgccgactcggaaaagggtcaggtggctgtcgat
gggatggcccattag

DBGET integrated database retrieval system