KEGG   Nitrosococcus halophilus: Nhal_1382Help
Entry
Nhal_1382         CDS       T01198                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nhl  Nitrosococcus halophilus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nhal_1382
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Nhal_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395403..1396044
Genome map
AA seq 213 aa AA seqDB search
MDKKLTKAVKEGHYIGSLDVEPGEHYDREFEASVKKILTRLGEDPDREGLKRTPQRVAKA
LDFLTSGYNMTVEEVVRDALFEDECEEMVIVKDVEFYSLCEHHVLPFFGRAHVGYLPRGR
IVGLSKIARVIDVFARRLQVQERLTTQIATGLMSVLNARGVGVVLEACHFCMVMRGVQKQ
NSQTVTSAMLGTFRQDPRTRAEFMELIRRSSGG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaattgaccaaggcggtgaaggaaggccactacattggtagcctggatgtg
gagccgggggagcactatgaccgggaatttgaagccagcgtgaaaaaaattttaacccgc
ctcggcgaagatcctgaccgtgagggactcaagcgcacgccacagcgggtcgccaaggcc
ctggatttcctcaccagtggttacaatatgaccgtggaggaggtggtcagggatgccctt
tttgaggacgagtgcgaagaaatggtgattgtcaaggatgtggaattctattccctctgc
gagcatcatgtattgccttttttcgggcgtgcccatgtgggttatttgccgagggggcgc
attgtgggcctgagtaaaatcgcccgagttattgatgtcttcgcccggcggctgcaagtg
caagagcgcctcactacccaaatcgccaccgggctgatgtcggtcctcaatgcccgcggc
gtgggagtggttctggaggcttgtcatttttgcatggtgatgcggggggtacagaaacaa
aatagccagacggtcaccagcgccatgttggggacgtttcggcaggaccctcgaacccgt
gcagaatttatggaattgattcgccgttcctcagggggttag

DBGET integrated database retrieval system