KEGG   Nitrosococcus halophilus: Nhal_1578Help
Entry
Nhal_1578         CDS       T01198                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nhal_1578
   01230 Biosynthesis of amino acids
    Nhal_1578
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_1578
   00030 Pentose phosphate pathway
    Nhal_1578
   00051 Fructose and mannose metabolism
    Nhal_1578
   00052 Galactose metabolism
    Nhal_1578
  Energy metabolism
   00680 Methane metabolism
    Nhal_1578
Enzymes [BR:nhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Nhal_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1604865..1605803)
Genome map
AA seq 312 aa AA seqDB search
MNTIVTITMNPSLDLSTEIEEMLPGRKLRTAPLRREPGGGGINVARGIQTLGGQVTALYT
VGGPTGQMLKELVDQEDINHYPLPIQRPTRESFAILESSSGHLFHFVSPGPELSQQEWQQ
CLDQIDQWKPKPTYLVASGSLPPGVPNDWYARLARIAKKQGMRLILDTSGPPLQAALEEG
VYLVKPNQHEFQNLTGHSVDTPEEQATLTREFVEQGKAEVVILTLGDKGALLTTREEQQR
AQPPKVKSISPVGAGDSFVAVITFNLARGRALKESLYYGVAAAAAALLTPGTELYRTEDM
ERIYQQMCREQH
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccattgtcaccatcaccatgaacccttcccttgacctctcaaccgagattgag
gaaatgctccctggacgaaaattgcggactgctccgcttcgtcgagaaccaggtggaggg
ggtattaacgtggcccgtgggattcagacactcggtggccaggtcactgccctttatacc
gtcggtggtccaacagggcaaatgctaaaggaactggttgaccaagaagatattaatcat
tacccccttcctatccaacgtcccactcgggagagttttgctatcctggaaagctcaagt
ggtcatctttttcactttgtctcacccggcccggaactgagccagcaagaatggcagcaa
tgcttagatcaaatcgaccaatggaaacctaaacccacctatctagttgctagtggcagc
ttaccgccgggagttccaaacgattggtatgcccggctagcacgaattgcgaaaaaacag
gggatgcgcctgatcttggatacctcagggccacccttacaggctgctttagaagaaggg
gtttatctggtcaaacccaatcagcatgagtttcaaaacttaacgggacattcagtagac
actccggaagaacaagccacactgactcgagaatttgttgaacaagggaaagccgaggtc
gttattttgactctaggggataaaggggccttgctgaccacccgggaagagcagcagcgc
gcccaacccccaaaagtaaagagcattagtccggtcggcgcaggagacagcttcgtcgcg
gtcattaccttcaatttagcccgcggtcgtgcccttaaagagtctctgtattacggtgtt
gccgctgctgcggcggcgcttttgactcctggcacagagctttaccgcactgaagatatg
gagcgtatttatcagcaaatgtgccgcgaacagcactga

DBGET integrated database retrieval system