KEGG   Nitrosococcus halophilus: Nhal_1587Help
Entry
Nhal_1587         CDS       T01198                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nhl  Nitrosococcus halophilus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Nhal_1587
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Nhal_1587
    3.5.1.-  
     Nhal_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1614877..1615536
Genome map
AA seq 219 aa AA seqDB search
MERPTITFNRESAVLLLVDIQPDFLPGGALPVAEGDQIIEPIRMLMESNTFCHYVATQDW
HPSGHISFASSHPGREPMEIIEIDNHPQTLWPDHCVQGTPGAEFHGSLPWEKVAAIIRKG
IDPESDSYSGFRNNWNPAGERPHTGLAGYLRERGMEEIFICGLARDVCVKWTAEDGAAAG
FNVYVLWDLTRPVEPSTDDQVRQELIAGDVKIIDSDQLS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggaaagacccacgattacgtttaatagagaaagtgctgtattattattagtggatatc
caaccggatttcctaccgggaggagcactgcctgtggccgaaggtgatcagattatcgag
ccgatacgcatgctgatggagtcaaatacattctgccattatgtggcgactcaagattgg
catccatccggtcatatctcttttgctagcagccatccagggcgtgaacctatggagatc
atcgagatcgataatcatccccagaccctgtggccggatcattgtgtccagggaacgccg
ggggctgagttccatggcagcctgccctgggagaaggtggcggctatcatacgcaagggg
atagatccagaaagcgattcttatagtggatttcgtaataattggaaccccgcaggtgag
cgccctcacactggattagctggttatttgagagagcggggcatggaagaaatatttatc
tgcggtcttgctcgggacgtttgtgtcaaatggaccgctgaagatggtgccgcggccggt
tttaatgtttacgtgctctgggatcttacccgtcccgtagagccttccaccgatgaccag
gtacgacaggaactgatagccggcgatgtcaagattattgattcggatcagctgagttaa

DBGET integrated database retrieval system