KEGG   Nitrosococcus halophilus: Nhal_1891Help
Entry
Nhal_1891         CDS       T01198                                 

Definition
PAS sensor protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
nhl  Nitrosococcus halophilus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:nhl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:nhl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1942207..1946295)
Genome map
AA seq 1362 aa AA seqDB search
MKRTDFPIVGIGASAGGLDSLKQLFNTLPDDSGMAFVLIQHLDPTHESLIVELLSRCTRM
KVVQVKDQMPVEVNRVYAIPPNKFIAIRDRFLYLSEPVLSHGIRMPIDFFLRSLAEDQEE
KAISIILSGTGSDGALGIKAIKNHGGMVMVQDPKTAQYEGMPSSAIVTGLVDFIQPVEDM
PGILLQYTQHAYIKTVSKTTEAPSKIADTLHSILSVLRAKTKYDFRYYKKGTLLRRINRR
LGLHHIEDMSRYLNFLRDNSTEATQLFKDLLIGVTGFFREEEAFKVLEEQVIAKLVQKKS
VDAPIRVWVPACSTGEEPYSIAILLTEQIQAAKKNCPLQIFATDIDTEALEIARTGIYPE
NIAADISSERLRRFFIKENHTYQINKPIRESVLFAEQNLITDPPFSKLDLISCRNLLIYL
EAEIQKKLIALFHFALNPGGYLFLGSTETISHQEGLFTPLSKKWRVYQRIGAIQHHLVEF
PIAFTGSKTGDIYAPAPPRPSEAARLAELTQKALLEDYAPASVLVNPKYRVLYFYGPTDR
YLRQPTGIPTDDLLTRIREGLHLKLRAALHRATQEKQQITVPNAHIRAEGTYHRVKITVK
PLQIPKTTEKLLLVSFQEEPERMLTEEHNTEVTAAEETLIRHLEQELKTTKTELHSTIEE
LETSNEELKAANEEIMSMNEELQSTNEELETSKEELQSLNEELNTVNSQLQDKVEELTVT
NNDLANLLQSPHITTLFLDREFRIKRYTPTITQLFNLIPTDIGRPISHIVHKFSNREALL
KEAATVLENLKPMEQEVHSDEDRWYIQRILPYQTEEHHIGGVVVTFIDITQRKQIENERQ
RLLVKIERERDKLRTLIDGISDEVWFCDAQGHLSLANRAAATAFGVERTEALYQPLSAWL
SRLEIYTPEGQPRTLEEAPLWRSLQGETLTHVEEIIRHPQTRQLRSRQVSSAPLKTKTGE
IMGAVAIARDITEEKEIETALREAKEKAVQASIHKSQFLATASHDLRQPLQTLSFLNDSL
TEKLKDPEIRRLIDQQGALLRNMGDLLNTLLDINKLEAGMVKPQFTVFPVASLLNYLRNE
FELHAREKGLNLRMVPCSVMICSDRILLEQILENLLSNAIKHTDRGKILLGCRRRSPNLR
IEVWDTGIGIPQEQLKVIFQEFYQADNPARDQRRGLGLGLSIVERLAHLLDHSLDIRSTP
GKGSMFAIEVPMAKENKEEPRESPPVEPPTESSPSHTPVLLIEDDPAISDALRLYLEMSG
FQLTTATHGNEALAQLEKGDIHPAVIISDYRLPGDKTGVQVIQHLRHLLGHRIPAIILTG
DTSPDWLQEAKEFDCQVHHKPIGGSQLVTIIQQLIRDARFSH
NT seq 4089 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggacagatttccctattgtggggatcggcgcttcggcaggagggctggactcc
ctcaagcagctcttcaacactctgccggatgatagcggcatggccttcgtactcatccag
catctggatcccacccatgagagcctgatagtagagcttttgtcccgatgcacccggatg
aaagtagtccaggtgaaggaccagatgccagtggaagtcaatcgagtctatgcgatcccg
cccaacaagtttatcgccattcgtgaccgcttcctctacctgagcgaaccggttttaagc
catggcatccgaatgcccattgattttttcctccgctccctagctgaagaccaagaagaa
aaggcgattagcatcattctctcagggacgggaagtgacggcgccctgggaataaaagcg
attaaaaaccacggcgggatggtcatggtacaggatcctaaaacggcccaatacgagggc
atgccgagcagcgccattgtcacgggtttggtcgatttcatccagcccgtggaggatatg
ccagggatcttgctccaatacacccagcatgcctatatcaaaacagtaagcaaaaccacg
gaagcaccttcaaaaatagccgatacgctgcattcaatcctatccgtgctgcgcgctaag
accaagtatgacttccgctattacaagaaaggcaccttgctgcgccgtatcaaccggcgc
ttggggcttcatcacattgaggacatgtcccgttacctgaactttctacgggacaattca
accgaagccacccaattattcaaggatctcctgatcggagtgacgggctttttccgcgag
gaggaggccttcaaggttctcgaagaacaggtgatcgcaaagctcgtgcaaaagaaaagc
gtggatgcgcctatccgggtttgggtcccggcttgctccaccggcgaagaaccctactcc
atcgccatcctgctcactgagcaaatccaggcagcaaaaaagaactgcccgctccagatc
ttcgctaccgatatcgacactgaggccttggagatagctcgaaccggaatctatcccgaa
aatattgccgctgacatctcatccgaacgtctgcgccgcttcttcattaaggagaatcac
acctaccagattaacaagccaatccgcgagtccgtgctatttgcggagcaaaatttgatt
actgatccccccttttccaagctcgacttgatcagttgtcgtaatctgctgatctatctc
gaagcggagatacagaaaaaactcatcgccctgttccactttgccctcaacccagggggc
tatctgttcctgggcagcaccgaaaccattagccaccaggaagggttatttacgcccctt
tccaagaaatggcgggtttatcagcggattggggctatacagcatcaccttgttgagttt
ccaattgctttcaccgggtccaaaacaggtgatatttatgcccctgctccgccgagacct
tcagaagctgctcgcctagccgaactcacccaaaaagcgctgttagaagactatgcccct
gcctccgtgctggtaaacccgaaatatcgagttctgtacttttacggccctaccgaccgc
taccttcgccaacctaccggcatcccgaccgatgacctcctcaccaggattcgggagggg
ttacacctcaaactccgcgctgccttgcatcgggccacccaggagaagcagcaaatcacc
gtccccaatgcccatattcgggctgagggcacttatcatcgggtaaaaatcacggtcaag
ccccttcagatcccgaaaaccaccgagaaattattgctggtcagcttccaagaagagccc
gaacggatgctaacggaagagcacaataccgaggtcacggcggcagaagaaacgctgata
cggcatctggaacaggagctcaaaaccaccaagacggagctgcacagcaccattgaggaa
ctagaaacctccaatgaagagttaaaagccgccaacgaggaaattatgtccatgaatgag
gaactccagtccaccaatgaggaactggagacctcgaaggaggaacttcaatccctcaat
gaagagctgaatacggtcaacagccagctccaagacaaggtagaagagcttacagtcacc
aataacgacctggctaatctcctgcaaagcccccatatcaccacccttttcctggaccgg
gagtttcggatcaaacgctatacacccaccatcacccagttatttaacctgatcccgacc
gacatcggtcgccccatcagccatatcgtgcataaattcagcaatagggaagcactgcta
aaagaagctgcaaccgtgctagaaaatctgaaacctatggagcaagaggtccattcggat
gaggatcgctggtatattcaacgcattctgccctaccaaacggaagagcaccacatcggc
ggtgtggtcgtgacctttatcgacatcacccagcgcaaacagatagagaatgagcggcaa
cggctgctggtcaagatcgagcgcgagcgggataaattgcgcaccttgattgatggcatt
agcgacgaagtctggttttgtgatgcccaaggtcatctttctctagccaatagggccgcg
gcaacggcatttggcgtggaacgcaccgaagcgttatatcagcccctatcggcatggctg
tcccggctagaaatctatacccccgaggggcaaccccggacgttagaggaggcgcccctt
tggcgttccttgcagggggaaaccctcacccatgtggaagaaatcatacgccatccccaa
acccgccagttgcggtctcgacaagtgagctccgcccccctaaaaaccaaaaccggtgaa
atcatgggggcggtggccattgcccgtgatattactgaggaaaaggaaatcgaaaccgcg
ctgcgcgaggcaaaggaaaaggccgttcaggccagtatccataaatcacaatttctcgcc
accgcaagccacgacctccgccagccgctacaaaccctcagctttcttaatgatagccta
acggaaaagctcaaagatccagaaatccgaagacttattgatcagcaaggagcgcttcta
aggaacatgggggacttgctaaataccttactcgacattaacaagcttgaagccggtatg
gtcaagccccaattcactgtctttcccgtagccagccttctcaactacctgcgcaatgaa
tttgagctgcacgcacgggagaagggattgaatttacggatggtgccctgctcggtcatg
atttgtagcgatcggatcctgttagaacagatccttgaaaatctgctctctaacgccatc
aagcacacagaccgaggcaagattctgctcggctgccgccgccggagccccaatctgcgc
atcgaagtgtgggacacgggcattggcattccccaagagcaactgaaagtcatttttcaa
gaattttaccaagccgataatcccgcccgggatcaacgcaggggactagggctgggtctg
agcatcgttgagcgcttagcccatctcttggaccactccctggatatccgttctacccct
ggaaagggctccatgttcgccattgaagtccccatggcaaaagaaaacaaagaggaacct
cgggaatccccgccggtggagccgcctacagaaagcagcccgtctcataccccggttctc
cttattgaagacgatcctgctattagcgatgccttgcgcctatacttggagatgtcaggt
ttccaactcaccaccgccactcacggcaatgaggccctagcgcaactggaaaaaggggat
attcaccccgcagtgattatctctgactaccgcttacctggagacaaaacaggagttcaa
gtcatccagcacttgcggcacctgctagggcaccggatacccgctatcattttgacaggg
gatacttcacccgattggttacaggaagctaaagagttcgactgtcaagtgcaccataaa
ccaattggaggctctcaactggtcactatcattcagcaactcatcagggatgcccgcttc
agtcactag

DBGET integrated database retrieval system