KEGG   Nitrosococcus halophilus: Nhal_1969Help
Entry
Nhal_1969         CDS       T01198                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nhal_1969
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nhal_1969
Enzymes [BR:nhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nhal_1969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2032404..2033636
Genome map
AA seq 410 aa AA seqDB search
MSIEAQALAAGKNYDQMPDERGHFGPYGGRFVAETLMGPIEELRQAYERYRNDSGFQAEL
EADLAHYVGRPTPLYFAKRWSEQLGGARIFLKREDLNHTGAHKINNTVGQALLARRMGKT
RLIAETGAGQHGVATATVAARFGLECVIYMGAEDMERQAPNVYRMRLLGAEVVPVTSGSQ
TLKDALNEAMRDWVTHVDNTFYVIGTVAGPHPYPAMVRDFQTIIGREARAQILEQTGALP
HALVACVGGGSNAIGLFHPFLKDEQVALYGVEAAGLGLETGQHAAPLCAGKPGVLHGNRT
YLMEDKHGQILDTHSLSAGLDYPGVGPEHAWLRDAGRATYVAVGDEEALAAFRALTRIEG
IIPALESCHALAYAMQLAPTLAQDQGIIVNLSGRGDKDINTVARIEGISL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaattgaagcccaggctttagcagccggcaaaaactacgaccagatgcctgatgaa
agggggcattttggtccctatggtggtcgttttgtggcagaaactttgatggggcccatt
gaagagctccgtcaagcctatgaacggtaccgtaatgattccggcttccaggccgaactg
gaagctgatctcgcccattatgtgggccggccgacgccgctgtattttgccaagcgttgg
agtgagcagttgggaggtgcccgcatctttttgaagcgagaggaccttaaccatactggg
gcccacaagattaataacacagtggggcaggccctgctggctcggcggatgggaaagacc
cgcttgattgccgaaacgggagcagggcaacatggggtcgccacggccacggtagccgcc
cgttttgggctggaatgcgtgatttacatgggggccgaggatatggaacggcaagccccc
aatgtctatcgaatgcgcctattgggagcagaggtggtgcccgtgacctcgggttctcag
actttgaaggatgccctcaatgaggccatgcgggactgggtcacccatgtggataacacc
ttttatgtcatcgggacggtggcgggtccccatccctaccccgccatggtacgggatttt
cagaccattatcgggcgggaggcccgggcccagattctggagcagacgggggcccttccc
catgctttagtggcttgcgtggggggaggttccaacgcgattggtttattccatcctttt
ctcaaagatgagcaagtcgccctctatggggttgaggcggcagggttaggtttggagacc
ggccagcatgccgctcccctctgcgctggtaagccgggtgttcttcatggcaatcggact
tatctgatggaagataagcatggccagattttagatacccattccctgtcggccggcctt
gattaccccggggtaggtcccgaacacgcctggttaagggatgcggggcgggccacctat
gtggcggtcggggacgaggaggctttggcggcattccgtgctctgacccgaattgaaggc
attattcccgccttggaaagctgccatgccttggcctacgctatgcaactggcgccgact
ctggcccaggaccagggaattatcgtgaatctttcaggacgaggagataaagatatcaac
acggtcgcccggattgaggggatctcgttgtga

DBGET integrated database retrieval system