KEGG   Nitrosococcus halophilus: Nhal_1969Help
Entry
Nhal_1969         CDS       T01198                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nhal_1969
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nhal_1969
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nhal_1969
Enzymes [BR:nhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nhal_1969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2032404..2033636
Genome map
AA seq 410 aa AA seqDB search
MSIEAQALAAGKNYDQMPDERGHFGPYGGRFVAETLMGPIEELRQAYERYRNDSGFQAEL
EADLAHYVGRPTPLYFAKRWSEQLGGARIFLKREDLNHTGAHKINNTVGQALLARRMGKT
RLIAETGAGQHGVATATVAARFGLECVIYMGAEDMERQAPNVYRMRLLGAEVVPVTSGSQ
TLKDALNEAMRDWVTHVDNTFYVIGTVAGPHPYPAMVRDFQTIIGREARAQILEQTGALP
HALVACVGGGSNAIGLFHPFLKDEQVALYGVEAAGLGLETGQHAAPLCAGKPGVLHGNRT
YLMEDKHGQILDTHSLSAGLDYPGVGPEHAWLRDAGRATYVAVGDEEALAAFRALTRIEG
IIPALESCHALAYAMQLAPTLAQDQGIIVNLSGRGDKDINTVARIEGISL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaattgaagcccaggctttagcagccggcaaaaactacgaccagatgcctgatgaa
agggggcattttggtccctatggtggtcgttttgtggcagaaactttgatggggcccatt
gaagagctccgtcaagcctatgaacggtaccgtaatgattccggcttccaggccgaactg
gaagctgatctcgcccattatgtgggccggccgacgccgctgtattttgccaagcgttgg
agtgagcagttgggaggtgcccgcatctttttgaagcgagaggaccttaaccatactggg
gcccacaagattaataacacagtggggcaggccctgctggctcggcggatgggaaagacc
cgcttgattgccgaaacgggagcagggcaacatggggtcgccacggccacggtagccgcc
cgttttgggctggaatgcgtgatttacatgggggccgaggatatggaacggcaagccccc
aatgtctatcgaatgcgcctattgggagcagaggtggtgcccgtgacctcgggttctcag
actttgaaggatgccctcaatgaggccatgcgggactgggtcacccatgtggataacacc
ttttatgtcatcgggacggtggcgggtccccatccctaccccgccatggtacgggatttt
cagaccattatcgggcgggaggcccgggcccagattctggagcagacgggggcccttccc
catgctttagtggcttgcgtggggggaggttccaacgcgattggtttattccatcctttt
ctcaaagatgagcaagtcgccctctatggggttgaggcggcagggttaggtttggagacc
ggccagcatgccgctcccctctgcgctggtaagccgggtgttcttcatggcaatcggact
tatctgatggaagataagcatggccagattttagatacccattccctgtcggccggcctt
gattaccccggggtaggtcccgaacacgcctggttaagggatgcggggcgggccacctat
gtggcggtcggggacgaggaggctttggcggcattccgtgctctgacccgaattgaaggc
attattcccgccttggaaagctgccatgccttggcctacgctatgcaactggcgccgact
ctggcccaggaccagggaattatcgtgaatctttcaggacgaggagataaagatatcaac
acggtcgcccggattgaggggatctcgttgtga

DBGET integrated database retrieval system