KEGG   Nitrosococcus halophilus: Nhal_2077Help
Entry
Nhal_2077         CDS       T01198                                 

Definition
3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
nhl  Nitrosococcus halophilus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nhal_2077
   01212 Fatty acid metabolism
    Nhal_2077
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Nhal_2077
   00650 Butanoate metabolism
    Nhal_2077
  Lipid metabolism
   00071 Fatty acid degradation
    Nhal_2077
   01040 Biosynthesis of unsaturated fatty acids
    Nhal_2077
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nhal_2077
   00310 Lysine degradation
    Nhal_2077
   00380 Tryptophan metabolism
    Nhal_2077
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Nhal_2077
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Nhal_2077
   00281 Geraniol degradation
    Nhal_2077
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Nhal_2077
Enzymes [BR:nhl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Nhal_2077
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Nhal_2077
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Nhal_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2148358..2150598
Genome map
AA seq 746 aa AA seqDB search
MRDTGNSQSLWVERREDNAAIIWFDVPDAPVNTLQAGFEQDFNHVLEQLTADKDLEAVVL
ASAKEDFIAGADIKMLTQLPDSEAARQLSHTAQGVMERVESFPLPIVAAIHGVCLGGGLE
VALACRARVASNSRRTQFGQPEVKLGVIPGVGGTQRLPRLVGLETALDMILTGKTIPAPK
ARAMGLVDEVVPRPVLLEAALARARELAWKELREKKEEEVRSSRRLGQVLGSLLSLGKLR
TLLLEENPAGRSVLFSQAKKKVLSHTHGNLPAPLQALEVIRTGIEEGLEAGFKAEVEAFG
DLAVSTKARNLMALFLARSALKKDLGTEAEVTPRAVHKVGVLGAGLMGSGVTYVTAAEAG
LPVRLKDVSHEVLRQGLRSLWKAVTEQVQKRRMTLGERDRVLALVRPTTEYTGFKRADVV
IEAVVENIEVKHQVLREVEAHGGPEMIFASNTSSIPIHKIAEASHHPEAVIGMHYFSPVP
KVPLLEVVVTEKTAPEVVATCVALGKRQNKTVIVVRDGAGFYTTRILGPYINEATHLLAE
GVSIEDIDRALINFGFPVGPIKLLDEVGIDVVQKIAQILQEAFGERMKPTSVLEKLVGAD
RFGKKNGQGFYRYQKVEGVFKGKQVDKSVYQLLDVKPHKKIEANEIAMRCLLPMVNEAVY
CYSDGILRSARDGDVGAVFGLGFPPFLGGPFRFIDNQGTGEIVERLTHYQKQWGERFTPA
PLLVELAQQGIGLHDKKTPPPGETLP
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagggataccgggaactcccaatcactgtgggttgaaagacgagaggataatgctgcc
attatttggtttgatgttcccgacgcccccgtcaatactctccaagcaggttttgagcag
gactttaatcatgtgcttgagcaactgacggcagataaggacctggaggcggtggtattg
gcctcagccaaagaggactttatcgcgggcgccgacatcaagatgttaactcaattgccg
gattctgaggcggccaggcagctctcacacacagcccaaggggtaatggaacgggtggaa
tcttttcctcttcccattgtggcggcaattcacggggtttgtctgggtggagggctggag
gtggctttggcctgccgggcgcgggttgcctccaatagccgtcgcacccagtttggccag
cctgaagtcaaattgggagtcattcctggggtgggcgggacccagcggctaccccgcctg
gtgggtcttgaaacggcactggatatgatcttgaccggcaaaacgattcccgcccctaag
gcccgggctatgggattggttgatgaagtggttccccggccggtccttttagaagcggct
ttggcccgtgcccgtgagcttgcctggaaagagttgagggagaaaaaggaagaggaggtt
cgctcttcccgccggcttggtcaggttcttggtagccttttgagcctggggaaacttaga
acactgcttttagaagagaatccggcaggccggtctgttttgtttagccaggcaaagaaa
aaggtcctgtcccatacccatggcaatttgccggccccccttcaggcgctggaggtgatc
agaaccggcattgaggagggtttggaagcgggttttaaggcggaagtggaagcctttggt
gatttggctgtgagcaccaaagcccgcaatctcatggccctgtttttagcgaggtccgcg
ctgaagaaggacctgggaacagaggcggaggtgacgccccgggcagtgcataaggtcggc
gttttgggcgcggggctgatgggaagcggggtaacttatgtgaccgctgctgaggcgggt
ttgcccgtgcgcttgaaagacgtcagtcacgaggtcttgcggcaaggactccgctcccta
tggaaggcggtgaccgagcaagttcaaaagcggcgcatgacgttgggggaacgtgaccgg
gtgctcgccttggtccgtcccacgaccgagtatacagggtttaaacgggccgatgtggtg
atcgaggccgtagttgaaaatattgaggtaaagcaccaggtactgcgtgaagtggaagcc
catggcggccccgagatgatttttgcttccaatacttcttccattcccatccataaaatt
gccgaggcgagccatcaccccgaggcggtgattgggatgcattatttctccccagtgcct
aaggtgccgctccttgaagttgtggtaaccgaaaaaacggcaccggaggttgtggccacc
tgtgtcgcgctcggtaaacgccaaaacaaaacggtgattgtggttcgtgatggagcggga
ttctatactacgcggatattaggtccctatattaatgaagccacccatcttttagccgag
ggagtctccatagaggatattgatagggcattgattaattttggctttccggtgggaccc
ataaagttgctagatgaagtgggtattgatgtggttcaaaagatcgcccagatcttgcaa
gaggccttcggtgagcggatgaaacccacatcagtgctggaaaaattagtgggggccgat
cgctttggcaaaaaaaatggtcagggtttctatcgttatcagaaagtggaaggagttttt
aaggggaagcaagtcgataaatccgtgtatcagttattggatgttaaacctcacaaaaaa
attgaggccaatgaaattgccatgcgctgtcttttgccgatggttaatgaggcggtgtac
tgctacagcgacggcattctgcggtcggcccgagacggcgatgtgggtgctgttttcggg
ctgggttttccaccctttttagggggaccctttcgctttattgataatcaaggcacgggc
gaaattgtcgaacggctcactcattaccaaaagcaatggggtgagcgttttactcctgcg
cctcttctcgttgaactcgctcaacagggaatcggtcttcatgataagaaaacgcctcca
ccgggggagactcttccctga

DBGET integrated database retrieval system