KEGG   Nitrosococcus halophilus: Nhal_2102Help
Entry
Nhal_2102         CDS       T01198                                 

Definition
phosphodiesterase/alkaline phosphatase D-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nhal_2102
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Nhal_2102
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nhal_2102
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Nhal_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2175683..2177224
Genome map
AA seq 513 aa AA seqDB search
MENLKSFQIEPLRNMVSVSAVKARSARLWIRSERPGILRLRWWKMGDQENAQEGYIEIEY
ENKNDNTRSVELPLTVDNLFLEPLTWYVYEVKNVADDQLIGVGSFETAPDHPDQTPHRFS
IALMSCNQPFNEDGSVRLESIQMLRAAKRCMRRHDTKFVLMVGDQMYSDHPQNLSLFNPK
YFSLIAPKGNKNILEYKSESIRKILQRRYRYFCNLADLKVIHTEYPCYPIWDDHDIVDNW
GSDPNHQNPQWQEFFKGAKLSCFDYQASRVMASQKELPDSFDYSFTYGNIALFVLDLRSN
RKAGRNGKLFSENQHIKIKQFLKTHRKKKVLFFVLSVPVIHLPRFLAKLAAKITYSGEDF
SDRWSSGAHVQDRNRFLETIYQHQLKHPSQKIILLSGDIHIGCVHRIKWEKEGPNIYQVV
SSPITHINSFFVQFFSKLLIRANRKISINNGLLSAKVNFLKGIKNYRKNPYGGLNLGLIE
IKTPQSGVDPEVRFYIYGHQGEEPVCVYCSPYV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttaaaaagctttcagattgagccgctccgaaatatggtatctgtcagtgct
gtaaaggcaagatcagcccggctatggattcgctcagaaagacccggaattttgcgttta
cgttggtggaaaatgggagatcaggaaaatgcacaggaaggatatatagaaattgaatat
gagaataaaaatgataacactcgcagtgtggaactgccacttactgtagataatttattt
ttagagcctttaacctggtatgtttatgaagtaaaaaatgtagcagatgatcagctcatt
ggagtgggatcctttgaaacagctcctgaccatcccgatcaaactccacatcgtttttca
attgcattaatgagctgtaatcagccatttaatgaagatggttcagtccgcttagaatct
attcaaatgctacgtgccgcaaagcgatgtatgaggcgtcatgataccaaattcgttttg
atggtgggagatcagatgtattctgatcatcctcaaaacctttctctttttaatccaaaa
tacttttctcttattgcgcctaaaggtaataaaaatattctggaatataaatctgaaagt
atacggaagatacttcaacgccgttaccgatatttctgtaatcttgctgatttaaaagta
atacacactgagtatccatgctatcctatctgggatgatcatgacatcgttgataattgg
ggttctgatccaaatcatcaaaacccccagtggcaggagttctttaaaggagcaaaatta
tcttgttttgattatcaggcttcccgcgttatggcttctcagaaggagctacccgattca
tttgattatagctttacctatggaaatatagccctttttgtcttggatctgcgttctaat
cgaaaagctggaaggaatggtaagcttttttctgaaaatcagcatataaaaattaaacaa
ttcttaaaaactcatagaaagaaaaaggtattgttttttgtgctgagtgtacccgttatc
catttacctcgttttctagcaaaactggcggctaaaatcacttattctggcgaagatttc
tcagatcgatggtcttctggcgcccatgtgcaggatagaaataggtttttagaaacgatt
tatcagcatcagcttaaacatccttcacaaaaaattattttgctgagtggcgatattcat
attggatgtgtccaccggattaaatgggagaaagaaggacctaacatttatcaagtggtt
tccagtcccattacccatattaattctttttttgttcaatttttctcaaaactgcttatt
cgggctaatcgaaagatatcaattaataatggtttattgagtgcaaaagttaatttttta
aaggggataaaaaactatagaaaaaatccttatggtggattaaatcttggtcttatcgaa
attaaaacaccacaatctggtgttgatccggaagttcgattttatatttacggacatcaa
ggggaagaacctgtgtgtgtttactgttcaccctatgtctga

DBGET integrated database retrieval system