KEGG   Nitrosococcus halophilus: Nhal_2117Help
Entry
Nhal_2117         CDS       T01198                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Nhal_2117
Enzymes [BR:nhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Nhal_2117
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nhal_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2190155..2191666)
Genome map
AA seq 503 aa AA seqDB search
MAASHVLSIDAGTTGITVLIFDQQGRIQGRAYSEFTQHYPRPGWVEHDPNEIWSVTQKVV
ATALHEAHLDPANLAAIGITNQRETVVMWDRRTGEPVAKAIVWQDRRTTPLCEALKARGL
EETFRHRTGLVIDPYFSGTKVKWLLDHVDGLRQRAEASEIAFGTVDSWLVWKLTGGKNHI
TDYSNASRTLLYNIHDLQWDEEILQMLQIPPALLPQVKPSSYVYGETVPQALPGSGGIPI
AGIAGDQQAALFGQACYGEGLAKNTYGTGSFVLMNTGKEAIFSQEKLLTTIAWGIGDDPV
EYALEGAIFITGAGIQWLRDGLGIISHASETEALARSVETNEGVYFVPALVGLGAPHWDP
YARGTLLGVTRGTTKAHLARAVLESMGYQTRDVVEAMERDSGIPLKVLRCDGGASVNRFL
MQFQADILGVAVEVPEITETTALGAAYLAGLATGFWHSREELDSQWQLAHRYEPTLPESE
RMGLYHQWQRAVERAKGWAQEKE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagtcatgtattatctatcgatgcgggcacgaccggcatcaccgttttgatt
tttgatcagcaggggcgcattcaaggccgagcctattcagagtttacccaacattatccc
cggccaggatgggtggagcatgatcctaacgagatttggtcagtcacccaaaaggtagtc
gccaccgccttgcacgaggcccatttagatcccgctaatctggcagcaatcggcatcact
aaccagcgggaaacagtggtgatgtgggaccggcgcacgggagagcccgtggcaaaagcg
attgtctggcaagataggcgcaccacccccctctgtgaagcactcaaagccaggggtcta
gaggagaccttccggcaccgaaccgggctggtcatcgacccctatttttcaggcactaag
gtcaaatggcttctcgaccatgtggatggcctcagacaacgggcagaagccagtgagatc
gcttttggaaccgttgattcctggctcgtctggaaactcactggcggcaagaatcatatt
accgattactccaacgccagccggaccctgctttacaacatccacgacctacagtgggat
gaggaaatcttgcaaatgctccagattccccctgccctgctgccccaagtcaagccctct
tcttatgtctatggggaaacagtcccccaagcccttcccggaagcggcggtattcctatt
gcgggaattgcaggggatcaacaggccgccctcttcggccaggcctgctatggggaagga
ttggccaagaacacgtacgggactggctcctttgtgctgatgaataccggtaaagaggct
attttcagccaggaaaagctgctgaccaccatcgcctgggggattggcgatgaccccgtt
gaatatgccttggaaggcgccatctttattaccggggcaggaattcaatggttgcgagat
ggcctaggaatcatcagccacgcctcagaaaccgaggccctagcccgctcggtggaaacc
aacgagggggtctactttgtgccggctctcgtcggccttggcgccccccactgggatccc
tacgcccgcggcaccttgctgggagttacccgcggcaccactaaagcccatctggcgcgg
gcagtgctagaaagcatgggctaccaaacccgagatgtggtagaggctatggaacgggat
tcgggaatcccgctaaaagtgctacgctgcgatgggggggcttcagtcaatcgctttctg
atgcaattccaggcagatatcctcggcgtggcggtagaagttcctgagattacagaaacc
accgccttgggggcggcctatttggcgggacttgccaccggattctggcatagccgtgag
gagctggattcccagtggcaacttgcccaccgctatgagcccactctacctgaatcggag
cgcatgggcctttaccatcagtggcaaagggccgtagaacgagccaaaggttgggcccag
gaaaaggagtag

DBGET integrated database retrieval system