KEGG   Nitrosococcus halophilus: Nhal_2154Help
Entry
Nhal_2154         CDS       T01198                                 

Definition
dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nhal_2154
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_2154
   00020 Citrate cycle (TCA cycle)
    Nhal_2154
   00620 Pyruvate metabolism
    Nhal_2154
Enzymes [BR:nhl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nhal_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2229046..2230335
Genome map
AA seq 429 aa AA seqDB search
MAEEFKFQDPGEGIHEAEIHEIRVSEGDSVEEGEILLDAETDKATFELPASFTGTIEQIK
VQEGDRAQVGDVLMTYRAKGEQAPTEEKAQPEEEKKTPPAEEISEKKQPKPEQPPKPEKG
PVPASPATRRLARELGVNLREVSGSGPAGRVESEDVRAYAEQKKKAPKEERPPQRAGRFP
PEVPPLPDFSQWGTVKTLPFRGIRRRTAERMALAWSQIPHVTHEDVADITELEDFRRQQK
ATVEAQGGRLSLTVLVMKAAVAALKKFPRFNASLDVESEEIILKEYYHLGIAVDSEQGLI
VPVIRDVDRKSLIDLAIELPQVVEQVQSGNMKPETMRGGTFTLTNPAAIGGTRFAPIVNY
PQVAILGMGRARLEPVIQGDREDFTVVPRLRLPLIVAFDHRINDGADAARFARAIVDILA
DPEAFMLAV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagagtttaaatttcaagatccgggggaaggtatccatgaagcggaaattcat
gaaatcagagtgtctgagggggactcggtagaagaaggagagattcttctggacgcggag
acggacaaggcgacctttgaactgccggcttctttcaccggcaccattgagcagatcaaa
gtccaagaaggggatcgggctcaagtaggtgatgtgttgatgacttatcgagcaaaggga
gaacaggctccgactgaggaaaaagcacagcccgaggaggagaaaaaaactccgccggca
gaagaaatctccgaaaaaaagcagccaaaaccggagcagccccccaagccagaaaaaggt
ccagtgccggcatcgccggcaacgcgacggttggcaagagagttaggtgtgaatttgcgg
gaggtttcagggagtggacccgctgggcgtgtggaatctgaagatgtcagagcgtacgca
gagcagaaaaagaaggcgcctaaagaggagagacccccacaaagagcgggccgttttcca
cccgaggttcctcctttgcctgatttcagccaatgggggactgtaaaaacccttccattc
cggggtatccggcgcagaaccgctgaacgcatggccctggcctggtcccagattccccat
gtcacccatgaagatgtcgctgatattacggaacttgaggattttcgccgccagcaaaaa
gccaccgtggaagcccaggggggtcggcttagcttgaccgtgttggtgatgaaagctgct
gtggcagcgcttaaaaaatttccccgctttaatgctagcctggatgtggagtcggaagag
attattttaaaggaatactatcatttggggatcgcggtagatagcgaacaaggattgatt
gtgccggtcatacgggatgtggatcgtaaaagtcttattgatttggccattgaactgccg
caagtggtggagcaggtacaaagcggtaatatgaaacccgagacgatgcgaggcggtacc
ttcacgctgactaaccctgctgccattgggggaactcgttttgctcccatcgtcaattac
ccccaggtggctatcttagggatgggccgcgcgcggctagaacctgtcattcaaggggac
agagaggattttaccgtggttccccgcttgcgtttgccattaattgtggcttttgatcac
cggataaatgatggggccgatgccgctcgttttgctcgagcaattgtcgacattttggct
gatccagaagcttttatgttggcggtttag

DBGET integrated database retrieval system