KEGG   Nitrosococcus halophilus: Nhal_2218Help
Entry
Nhal_2218         CDS       T01198                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nhl  Nitrosococcus halophilus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:nhl00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:nhl00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2298643..2299188
Genome map
AA seq 181 aa AA seqDB search
MKAKPTKLPEVLLIEPRVFGDKRGFFFESYNKIAFAAATDIQAEFVQDNHSCSARHVLRG
LHYQIRQPQGKLVRVVAGEVFDVAVDLRRSSSSFGHWVGCHLSAENKHQLWVPEGFAHGF
LVLSEYAEFLYKTTDYYAPEYERCIRWDDPELAIDWPLEKAPLVSTKDQAGVAFKEAELF
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctaagccgactaagctccccgaggttttgctcattgaaccccgtgtctttggt
gacaagcggggttttttctttgaaagctataacaagatagcctttgcggcagccaccgat
attcaggccgagtttgtacaagacaaccattcttgctcggcaaggcacgtcctacggggt
ttacactaccagattcggcagccccaaggtaaattggttcgggtcgttgcgggtgaagtc
tttgatgtggccgttgatctgcggcgcagttcttctagttttggccattgggtcggttgc
cacctctcggcggaaaacaagcatcagctctgggtgccagaaggatttgcccacggtttt
ttagtgctaagtgagtatgcggagttcttatataagaccacggactactatgccccggaa
tatgagcgttgcattcgctgggatgatccggagctggctatagactggcccttggagaag
gctccgctggtctccaccaaggaccaagcaggtgtcgcttttaaagaggcggagctgttc
ccatga

DBGET integrated database retrieval system