KEGG   Nitrosococcus halophilus: Nhal_2221Help
Entry
Nhal_2221         CDS       T01198                                 

Definition
(GenBank) aspartate/ornithine carbamoyltransferase carbamoyl-P binding domain protein
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00240  Pyrimidine metabolism
nhl00250  Alanine, aspartate and glutamate metabolism
nhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nhal_2221
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nhal_2221
Enzymes [BR:nhl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Nhal_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADE15312
UniProt: D5C589
Position
complement(2302241..2303323)
Genome map
AA seq 360 aa AA seqDB search
MVKKFNPLLKEPLQPKDDTAGIERPLALMEQIPENPAPLVDLANRPILSARQFDREKVIQ
LSRLAALYETTPTRMQLPLTGKILINAFYEPSTRTRLSFESAWHRLGGDVMSITDPATTG
IAKGETLADVAEMFNNYGDLVVLRDGSEEAVYKMLESLRIPIINAGNGIDEHPTQGLADL
YTLFKWRPELIAPKVPAETQIRVGIVGIPGYMRTVRSLLLFLALFAPAIKEVVVICHQED
VFAKDQREELELSGLTLRIARHLNPELPTLDVVYINSIAWVGDSFEKLGEGLGLRQSSPL
KPGAIILHPLARGEELSTDLDNTEHNWYFAQARGAVFMRMALLTSLVQRIDQVMDTPGQS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaaattcaaccctctattaaaggagcctttacagcccaaggatgatacggcc
ggcatcgagcggcccttggccctcatggagcagattccagaaaatccggcgcctttggtg
gatctggctaatcgccctatactcagcgctcgccagttcgaccgggagaaagtcattcaa
ctcagccgtctagcggccctttatgagactacccccacccggatgcaactgcccctcacg
ggtaagattctcatcaatgccttttatgaacccagcacccgtacccgactttcatttgag
agtgcctggcatcgactaggcggcgatgtaatgtccattaccgatccggccactacgggc
attgccaagggggaaaccttggccgacgtggccgagatgttcaataactacggagattta
gtggtactgcgggatggcagcgaggaggccgtctacaaaatgctggaatccttgcgtatt
cccattatcaatgcagggaacggcattgatgagcatcccacccagggcttagccgatttg
tataccttgttcaagtggcgacctgagttgatagcaccgaaggtcccggccgagacccag
ataagggtgggcatcgtaggaatacccggttatatgcgcaccgtgcgcagtctgctgttg
ttcctggccttatttgcaccagcgataaaagaagtggtcgtgatttgccaccaggaagac
gtatttgcaaaagatcagcgggaggagctagaactttccggtcttaccctccgaatagcc
cgccatctcaatcctgaacttcccaccttggacgtggtgtacatcaattccattgcttgg
gtaggagacagttttgaaaagctgggagaaggcttgggacttcgccagtcttctccccta
aaaccgggggcgattattctccatcccttggctcggggggaggaattgtccactgatttg
gacaatacggagcataattggtactttgcccaagcccggggggccgtatttatgcgcatg
gctttactcacttcccttgttcaacgtatcgatcaggtgatggacaccccagggcaaagc
tag

DBGET integrated database retrieval system