KEGG   Nitrosococcus halophilus: Nhal_2429Help
Entry
Nhal_2429         CDS       T01198                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nhl  Nitrosococcus halophilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Nhal_2429
   00052 Galactose metabolism
    Nhal_2429
   00500 Starch and sucrose metabolism
    Nhal_2429
   00520 Amino sugar and nucleotide sugar metabolism
    Nhal_2429
Enzymes [BR:nhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Nhal_2429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2495257..2496144
Genome map
AA seq 295 aa AA seqDB search
MTQPITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIEAGIKVMIFVTGR
NKRPIPDHFDKAYELEVELERRGKSKLLELIRDIIPKGVTCVYIRQEETLGLGHAVLCAA
PVVDEQPFAVILADDLINAEEEGCLSQMTKQFSKHRCSLVGVEEVDPESTDQYGIIQPGL
AEGREYKVEGIVEKPKPVEAPSSLAVVGRYILTPRIFNLLQATPRGVGGEIQLTDALATL
LSQEYMFAYRFKGKRYDCGSKLGYLQATVEYGLKHGELGDSFRDYLGHLLAHEEL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaccaattactaaggccgtgtttcctgtggcgggtctaggtactcgttttctt
cctgcgaccaaagcaagtccgaaagagatgctgccaattgtggataagcctttgattcaa
tacgcagttgaagaggctattgaggcaggaattaaagtcatgatttttgtcaccgggcga
aataagcgacccattcctgatcatttcgataaggcctacgagttagaagtggaattggaa
aggcgtggcaaaagcaagctactcgaattgatacgggatattattcccaagggcgtgacc
tgtgtttatatccgccaagaggaaaccctcgggttagggcacgcggttctctgtgcggca
ccagtcgtggatgagcaaccctttgcggtgatccttgccgatgatctgattaatgcggaa
gaggaggggtgcctctcccaaatgacgaagcaatttagtaagcatcgttgcagcttagtc
ggggtggaggaagtggatccggaaagtaccgatcaatatggtattatccagcccggtttg
gctgaggggcgagagtataaggtggaggggattgtggagaaacccaaaccggtagaggcc
ccttcttcactggcagtcgtgggtcgttatattttgacgccccgtatctttaatctattg
caggccactccccgtggtgttggcggcgagattcaattgactgatgcactcgctaccttg
ttgagccaggaatatatgttcgcttatcgctttaaaggtaagcgttatgactgcggcagt
aaattaggttatcttcaggccaccgtggaatatggtcttaagcacggtgagttaggcgac
tcttttagagattatttgggccatctgctagcccatgaagaactttaa

DBGET integrated database retrieval system