KEGG   Nitrosococcus halophilus: Nhal_2433Help
Entry
Nhal_2433         CDS       T01198                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nhl  Nitrosococcus halophilus
Brite
Enzymes [BR:nhl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nhal_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_4 NodS ANAPC4 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ADE15521
UniProt: D5BVU2
Position
2501769..2502428
Genome map
AA seq 219 aa AA seqDB search
MKKNLLGTGMTSQRSRDWLVQRLREEGVRDPKVLKAIQKTPRHIFVDEALSSRAYEDTAL
PIGFGQTLSQPYIVARMTESLLAGGPLQKVLEVGTGSGYQTAILANLAGLVYTVERIKPL
LMQAQRRFNRLGITNIRLKCADGFWGWPACGPYQGILVTAAPMEVPQSLLKQLAIGGRMV
IPVGAQGAQSLILVTRTSDDFEIETLERVSFVPLVGEQI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatttgcttggcaccgggatgacttctcagcgtagccgagactggctggtc
cagcggttgcgtgaagagggtgtccgggatcctaaagtgctcaaggcaatacaaaagacg
cctcgccatatttttgtggatgaggcgctttcaagtcgggcctatgaagatacggccctc
ccgattggttttgggcaaacgctctcgcagccctatattgtggcgcgtatgacagagtca
ctccttgcgggaggaccgctccagaaagtattggaggtgggtacaggctctggttatcaa
acggcaattttagcgaacttagcagggctggtgtatacggtagaacgaatcaagcctctg
ctgatgcaggcccaaagacgcttcaatcgccttgggatcaccaatatccgacttaaatgt
gccgatggtttttgggggtggccagcctgtgggccttatcaaggtatactggtgaccgct
gcgcctatggaggtaccccagtcattactcaaacaattggctataggggggcgaatggtg
attccggtaggggcgcagggggcccaatccttaatattagtgactagaacctctgacgat
ttcgaaatagaaaccttggagcgggtcagttttgtgcctctcgtaggagagcaaatttga

DBGET integrated database retrieval system