KEGG   Nitrosococcus halophilus: Nhal_2489Help
Entry
Nhal_2489         CDS       T01198                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nhl  Nitrosococcus halophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nhal_2489
Enzymes [BR:nhl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Nhal_2489
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nhal_2489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2560592..2562541
Genome map
AA seq 649 aa AA seqDB search
MAIPRGLKTAETVRHDVSLLTEQDVYFFKEGTHTKLYHKLGAHLISVEGVKGTYFALWVP
NAERVSVIGDFNQWNSETHALKQRPDSSGIWEGFIPGVSPGTRYKYRIVSKYRNYQIDKG
DPFAFFWEAPPQTASRVWSLDYEWGDGEWMARRHQANSLDAPLAIYEVHLGSWQRVPEED
NRSLTYREMAEKLAEYVKDMGFTHVELLPVTEHPFYGSWGYQTTGYFAPTARYGTPQDFM
YLVDHLHQNGIGVILDWVPSHFPNDAHGLTYFDGTYLFEHADPKKGFHREWSSYIFNYDR
HEVRAFLMSSALFWLEQYHIDGIRVDAVSSILYLDYGRQEGEWIPNEYGGRENLAAICFL
RELNEAAYGAYPDIQTIAEESTAWPMVSRPSYVGGLGFGMKWNMGWMHDTLDYFSKDSIF
RKYHHDQLTFSIWYAFSENFVLALSHDEVVYGKGSLFGRMSGDEWQKFANLRVLFGYMYG
HPGKKLLFMGGEFAQGREWNHDQSLDWHLLQNPPHQGVQRWVSNLNHFYRAEPALYEQDF
VTAGFEWIDCHAWEESIISFIRKDKTGKDMILVVCNFTPVLRTNYRIGVPRGGDWREALN
SDSELYGGVGHGNFGGVEAVPFPAHGRANSLMLTVPPLSVLFFKNQQLI
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
gtggcaataccaagagggctaaagacggcagaaacggtcaggcacgatgtcagcctcctg
accgaacaggatgtctatttttttaaggagggcactcacaccaaactttatcataagtta
ggtgctcaccttatttctgtagaaggggttaaaggaacctattttgctctctgggtcccc
aacgcagaacgggtttccgtcatcggggatttcaaccaatggaattctgaaacccatgcc
ctcaaacaaaggcccgacagctcgggtatttgggaaggattcattcccggagtttcccct
ggaactcgatataaatatcgtattgtatccaagtatcggaattatcagatcgataagggt
gatccgtttgcatttttctgggaggcgccacctcagacagcttcccgggtctggagtctg
gattacgagtggggcgatggtgaatggatggccagaaggcaccaagccaatagccttgat
gctccattggccatttatgaagttcacctagggtcatggcaacgggtgcctgaagaggat
aaccgctccctgacttatcgggaaatggcggagaaattagcggagtatgtcaaggacatg
gggtttacccacgtggaacttctaccggtgacggagcaccctttttatggttcctggggt
tatcagacaactggctattttgcccctacggcaagatatggaacgcctcaggatttcatg
tacctcgttgatcatctccaccaaaacggcattggtgtgattcttgattgggttccttca
cactttcccaatgatgcccatggtttaacctattttgatggcacttatttgtttgagcat
gctgatcctaaaaaaggatttcatcgagaatggagcagttatatttttaattatgatcgc
catgaggtcagggcatttctcatgagcagtgcattattttggttagaacaatatcacatt
gatggaatccgagtagatgcagtaagctcgatactttatttagattatggcaggcaagaa
ggtgaatggattcctaatgaatatggagggagggagaatttagccgctatttgttttctc
agggaactcaatgaggccgcgtacggggcctatcccgatatacagaccattgctgaagag
tcaacggcctggccgatggtttcaagaccgagctatgtggggggactcggtttcggtatg
aagtggaacatgggttggatgcacgatactttagattatttttccaaagactccattttt
agaaaatatcatcacgatcaattaacctttagcatttggtatgctttttccgaaaacttt
gtccttgctctttcccatgatgaagtggtgtatggaaaggggtctctcttcggcaggatg
tccggtgatgagtggcagaaatttgctaatttaagagtgctgtttggttatatgtatggc
catccaggaaagaaattgttatttatgggaggggagtttgctcagggacgggaatggaat
catgaccagagcttggattggcatctcctgcaaaatcctccccatcagggagtccagcgt
tgggtcagcaatcttaatcacttttaccgagccgagccggccctgtatgagcaagatttt
gtaaccgcaggttttgaatggattgattgccatgcttgggaggaaagcatcattagtttt
atcagaaaagataaaactggcaaggatatgattctggtggtctgtaattttactccggtt
ctcagaacgaattatcggatcggtgttcctcgggggggagattggagagaagcgcttaac
agcgatagtgagctttacggaggtgtggggcatggtaattttgggggcgttgaggcagtc
cctttccccgcccatggaagagcgaattccctaatgttgacagtgccgcccctcagtgtc
ctattttttaagaaccagcagttaatctaa

DBGET integrated database retrieval system