KEGG   Nitrosococcus halophilus: Nhal_2580Help
Entry
Nhal_2580         CDS       T01198                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
nhl  Nitrosococcus halophilus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Nhal_2580
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Nhal_2580
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Nhal_2580
Lipid biosynthesis proteins [BR:nhl01004]
 Fatty acid synthase
  Component type
   Nhal_2580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2655725..2656306
Genome map
AA seq 193 aa AA seqDB search
MVAGAALQPVIVVLGDSLSASYGIPLDQGWVTRLQERLTREGYPYQVVNASISGETTRGA
LARLDPLLETHQPEIVVVELGGNDGLRGLSLGEMRRNFSQIIQKSQQSGAKVLLVRMRLP
PNYGPLYTERFQKLFADLKNEYGVAIAPFILHGIATRSELMQSDGIHPRPEAQALMLDNI
WPALVPLLLGVSP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccggggccgcgctccagccggtcatcgtagtcctaggcgatagtctgagtgcc
agctatggtatccctctcgatcaaggttgggtcacgcggctccaggaacgtttgacccgt
gaaggctacccttatcaggtggttaatgccagtattagcggagaaactacccgcggcgca
ttggctcgccttgatcctcttctggagactcatcagccggaaattgtagttgtcgagttg
gggggcaatgacggtctacgggggttatcgctgggggaaatgcgacgaaacttttcccag
attattcaaaaatctcagcaaagcggcgccaaggtgttacttgttaggatgcgcttgccg
cctaattatggtcctttgtacacggaaaggttccaaaaactatttgccgatcttaagaac
gagtatggagtggccatcgcaccctttatcctgcatgggattgccacccgatcagagtta
atgcaatctgatggtatccatcctcgccctgaggcccaggcccttatgctcgacaacatt
tggccggcattagttccactgcttcttggagtttcgccatga

DBGET integrated database retrieval system