KEGG   Nitrosococcus halophilus: Nhal_2695Help
Entry
Nhal_2695         CDS       T01198                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00010  Glycolysis / Gluconeogenesis
nhl00620  Pyruvate metabolism
nhl00640  Propanoate metabolism
nhl00680  Methane metabolism
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01120  Microbial metabolism in diverse environments
nhl01130  Biosynthesis of antibiotics
nhl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_2695
   00620 Pyruvate metabolism
    Nhal_2695
   00640 Propanoate metabolism
    Nhal_2695
  Energy metabolism
   00680 Methane metabolism
    Nhal_2695
Enzymes [BR:nhl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Nhal_2695
Lipid biosynthesis proteins [BR:nhl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Nhal_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADE15770
UniProt: D5BX87
Position
complement(2761353..2763320)
Genome map
AA seq 655 aa AA seqDB search
MNEESIESTLHEERLFPPPAEFSAKARIPDRATLDSLVQAANEDFEGFWAAQARAEITWH
KPFKTVLDSTNPPHYQWFTDGELNVSYNCLDRHLQDKADKIAIIFEGEPGDITTFTYHQL
HQRVCRFANVLKAQGVTEGDRVVIYLPMVPEAVIAMLACARIGAIHSVVFGGFSAESLKD
RIEDAEAKLLITADGGHRGGRIVELKAAANRALKEGCNSIQHVIVLQRTGHDIDMTEGRD
LWWHEAETRIDGNCEPVWLNAEHPLFLLYTSGSTGKPKGIQHASGGYLLGALTTMKWVFD
IRDEDIFWCTADVGWVTGHSYIAYGPLAAGATIVMYEGTPTFPDPGRFWKICQDHGVTIF
YTAPTAIRALMKYGDDLPAGYNLSQLRLLGTVGEPINPEAWMWYHCIIGGERCPIVDTWW
QTETGVHMIAPIPGAVPTKPGSCTLPLPGISAAVVDEKGHPITTPDRGGYLVITKPWPSM
LRTIWGDDQRYYDTYWSKFGSQYYLTGDSARRDKDGYFWIMGRTDDVLNVSGHRLGTMEI
ESALVAYPKVAEAAVVGRPDDIKGEAILAYVILKGSRPTGGVGKTLTEELRAWVADQIGP
IAKPDEIRFVDSLPKTRSGKIMRRLLRTIARGEPITQDTSTLESEAILSQLQGKE
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaaagtatcgaatccactttacatgaagaacgccttttccccccaccagct
gaattttcggccaaagcccgcatccccgaccgtgccaccttggattccttagtccaagcc
gccaacgaagacttcgaaggtttttgggccgcgcaggcacgtgcagaaattacctggcat
aaacccttcaaaacagttctagacagcactaatcccccacactatcagtggtttaccgac
ggcgaactgaatgtctcttacaactgcctagaccgccacctgcaggacaaagccgacaaa
atagccattatttttgaaggagagccgggggatattaccaccttcacttatcatcaatta
caccagcgagtttgccgctttgctaatgttcttaaagctcaaggtgttaccgaaggcgat
cgggttgtcatctacctacccatggtccccgaagccgtcattgcaatgttggcctgcgcc
cgcatcggggccatccattcggtcgtatttggaggtttctccgccgaatcccttaaagat
cggattgaggatgcagaagccaaacttcttatcactgccgatgggggtcaccggggcgga
cgcatcgtcgaactcaaagcagcggctaaccgggcattaaaagaaggatgcaacagtatc
cagcatgtcattgtcctgcaacgtacgggtcatgatatcgacatgaccgaggggcgcgac
ctatggtggcatgaagcagaaaccagaatcgatggaaactgtgagccggtatggctaaac
gctgagcatcctttattcctgctttacacctctggttccactggcaaacccaagggcatc
cagcatgccagtggcggctacctgctcggtgccctcactaccatgaaatgggtctttgat
attcgtgatgaggacatcttttggtgcacggccgatgtgggctgggtcacaggccatagt
tatatcgcctacggaccgctggcagcaggagccactattgtcatgtatgagggaactccc
acttttcctgatccgggccgtttttggaaaatctgccaggatcatggagtcaccattttt
tacacggcccccactgctatccgggctctaatgaagtacggggatgatcttcccgccggc
tataatttatctcaattaaggctgctgggaacggtgggcgaacccatcaaccccgaggct
tggatgtggtatcactgcattatcggaggcgagcgctgccctattgtcgatacttggtgg
caaacggagacgggagttcatatgattgccccaattcctggcgctgttcccaccaaaccc
ggctcctgcaccctccctctgcctggcattagcgctgcagtggttgatgaaaaggggcac
cctattaccacccctgatcggggcggttatttagtcattaccaaaccctggccctccatg
ctccgcaccatttggggcgatgatcagcgttactatgatacctattggagcaaattcggc
agccaatattatcttacgggtgacagtgcccgccgcgataaggatggctatttttggatc
atggggcgcactgatgatgtattgaatgtgtccggtcatcggctcggcaccatggagatc
gaatccgccttagtggcttatccgaaggtagcagaagcagccgtggtgggccgtcctgac
gacatcaagggtgaggccatcctcgcctatgtcatcctaaaaggaagccgcccaacagga
ggggttggtaaaactttgaccgaggaacttcgagcctgggtcgccgatcaaattgggcct
atcgccaaaccggatgagattcgttttgtggacagcctccccaaaacccgctccgggaaa
atcatgcgccgcttacttcggaccatcgcccggggtgaacccatcactcaagacacctct
accctagagagtgaagctatcctctcccaacttcagggcaaagagtaa

DBGET integrated database retrieval system