KEGG   Nitrosococcus halophilus: Nhal_2906Help
Entry
Nhal_2906         CDS       T01198                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Nhal_2906
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Nhal_2906
Enzymes [BR:nhl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Nhal_2906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2975997..2976461
Genome map
AA seq 154 aa AA seqDB search
MLLSSMAEIIRGIGLMMGLAVSFFIVPATAALLDTISPPEGVGSSIYVYKDVKRKMVLIV
GSSGTCASSPEYQELGDLSDQGAVPLLTQIAAEQFGAGGEKLFKSHCQMNYDVQVITFED
TQSSSFPPDPIDRSFNAPGGPSPEGHRNERLRNL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgtccagtatggctgaaattatccgcgggataggtttaatgatgggattggcg
gtgtcttttttcatagttcccgctactgctgctttgctagacacaattagccctccagag
ggtgttggaagctctatctatgtatataaggatgttaaacgtaagatggtgctgatcgtt
ggttctagtggtacctgcgcctcatcgcctgagtatcaagagttgggcgatttatccgac
caaggcgccgttcctttactgacccaaattgccgccgagcagtttggggctggaggtgag
aagctttttaagtctcattgccagatgaattacgacgttcaggtgatcaccttcgaggat
acccaaagctcttcttttccacccgatcccatcgatcgctctttcaatgctccagggggg
ccttccccggaaggccatcgaaatgaacgtctaaggaacctgtaa

DBGET integrated database retrieval system