KEGG   Nitrosococcus halophilus: Nhal_2906Help
Entry
Nhal_2906         CDS       T01198                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:nhl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:nhl00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2975997..2976461
Genome map
AA seq 154 aa AA seqDB search
MLLSSMAEIIRGIGLMMGLAVSFFIVPATAALLDTISPPEGVGSSIYVYKDVKRKMVLIV
GSSGTCASSPEYQELGDLSDQGAVPLLTQIAAEQFGAGGEKLFKSHCQMNYDVQVITFED
TQSSSFPPDPIDRSFNAPGGPSPEGHRNERLRNL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgtccagtatggctgaaattatccgcgggataggtttaatgatgggattggcg
gtgtcttttttcatagttcccgctactgctgctttgctagacacaattagccctccagag
ggtgttggaagctctatctatgtatataaggatgttaaacgtaagatggtgctgatcgtt
ggttctagtggtacctgcgcctcatcgcctgagtatcaagagttgggcgatttatccgac
caaggcgccgttcctttactgacccaaattgccgccgagcagtttggggctggaggtgag
aagctttttaagtctcattgccagatgaattacgacgttcaggtgatcaccttcgaggat
acccaaagctcttcttttccacccgatcccatcgatcgctctttcaatgctccagggggg
ccttccccggaaggccatcgaaatgaacgtctaaggaacctgtaa

DBGET integrated database retrieval system