KEGG   Nitrosococcus halophilus: Nhal_2977Help
Entry
Nhal_2977         CDS       T01198                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nhl  Nitrosococcus halophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nhal_2977
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Nhal_2977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3055869..3058061)
Genome map
AA seq 730 aa AA seqDB search
MKPPLHSETPPEFLTGAVERVTFHSEENGFCVLRIKVRGERDLITVVGNTPTVTPGEYVE
CHGEWVNDRTHGLQFKTKHLRVIPPSTLEGIEKYLGSGMVKGIGPHFAKKLVQAFGEQVF
EVIEHESERLTELDGIGPKRKEQVIQAWAEQRVIRAIMVFLQSHGVGSARAVRIYKTYGD
KAIERVRENPYRLALDIHGIGFKTADRIAQRLGIPADSLIRAQAGVRHVLQEFANEGHCA
MEQGRLVETASQLLEIPAPIIEQAITQEVAEGQLIAEIIAGKPCLFLAPLYRSEIGVAKH
LQRLLRGVPPWGQINADKAIPWVEAKTGLLLSPSQRVALIQTINNKITVITGGPGVGKTT
VVNSILRIVRAKQTQVLLGAPTGRAAKRLAESTGLEAKTIHRLLEFDPHAMGFKHHAANP
LQADLIVIDEVSMVDVGLMNQLLQAIPNHAACILIGDKDQLPSVGPGQILADIIASQKIS
TVHLSEVFRQAASSKIVVNAHRINQGKMPEKADEAATLSDFYFIPTKSPETIQDRVLELV
TSRIPKRFGFDSTRDIQVLTPMNRGSLGARALNGLLQQQLNGQSQPKINRFGWSFAPGDK
VIQTVNNYDKEVFNGDIGRITRIALEEGLVHIDFDGREIEYELGELDEIALAYATSVHKS
QGSEYPAVVIPLAIQHYTLLQRNLLYTGITRGKRLVVLVGQPKALAIAVKRINSTARLTH
LSARLANSQI
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccccctccactcagaaactccacccgaatttctcactggtgctgtagaacgc
gtcactttccatagtgaggaaaatggattttgtgtcctacgaattaaagtgcgtggtgag
cgggatctcatcaccgtggtcggcaataccccaacggtcacgccgggtgagtatgttgaa
tgccacggtgagtgggtcaacgaccgcacccatggtctccaatttaagaccaagcattta
agagttatccctcctagcaccctagaaggaatcgaaaaatatctaggctcaggaatggtc
aaaggaatcggtccccactttgccaagaaattggtacaagcctttggcgaacaggttttc
gaagtcatcgagcacgagtctgagcgcctcaccgaattagacggtatcggccccaaacgc
aaagaacaagtcattcaggcctgggcagaacagagggtcattcgagccatcatggtgttt
ctacaatcccatggagtgggtagcgccagggcagtccgtatttataaaacctatggcgac
aaagccatcgagcgggttcgcgaaaacccctaccgacttgcactcgatatccatggcatt
ggctttaaaactgccgataggattgcccaacggctgggaatccctgccgattctctcatc
cgcgcccaggcgggggttcgtcatgtgctccaggaatttgctaatgaaggacactgtgcc
atggaacagggacgattagtggaaacggctagccaattgctggaaatccccgcccctatc
attgaacaagccattactcaagaagtcgctgaaggacaactaatagccgagatcattgcg
ggcaaaccctgcctatttctagctccactttatcgatcagaaataggcgtggccaaacat
ttgcagcggcttctccgaggggtacccccctggggacaaattaatgccgataaagcgatc
ccctgggttgaagccaaaacaggattgttactctccccctctcaacgggttgcccttatt
caaacaatcaacaacaagatcaccgtcatcaccgggggacctggtgtcggcaaaaccacc
gtcgtcaacagcattctccgaattgttcgggccaagcaaacccaggtactcctgggggcc
ccgaccgggcgggcggcaaaacggctagccgaatccactggcctggaagccaaaacgatc
catcgtctgcttgaattcgatccccatgcaatgggtttcaagcaccatgcggccaacccc
cttcaagccgatctcatcgtcattgatgaggtttccatggtagacgtggggttgatgaat
caattgctccaagctattcctaatcatgcagcatgcatactgataggcgataaagaccag
ttaccttcggtgggacccgggcagatactcgcggatattatcgcctcccaaaaaatctcc
accgttcacctcagcgaagtctttcgccaggcagccagttccaagatcgtcgtcaatgcg
caccgaatcaatcaaggaaaaatgccagagaaagccgatgaagcggccacacttagcgac
ttctacttcattcccaccaaatctccagaaactatccaggatagggtgctggaattggta
accagccgtattcccaagcgtttcggatttgattctactcgcgacattcaagtccttacc
cccatgaatcggggcagtctcggtgcgcgagcactgaatgggctcttgcaacaacaactc
aatggacaatctcaacccaagatcaatcgctttggttggagctttgcccccggcgataag
gtcattcaaactgtcaataattatgacaaagaagtgtttaatggggatattggaaggata
accaggatagcccttgaggaaggactcgtacatatcgacttcgatggccgagagatagaa
tacgaattaggcgaacttgacgaaattgctttggcctatgccacctcggtgcacaagagc
caaggctcggaatatcccgcggtcgtcattcccctcgccattcaacattacaccctgtta
caaagaaacctgctttacaccggcattacccggggcaaacggctagtggtacttgtggga
caacctaaggccctcgccattgccgtcaaaaggatcaattcaaccgctcggctgacccat
ctttcagcccgattagctaacagtcaaatttaa

DBGET integrated database retrieval system