KEGG   Nitrosococcus halophilus: Nhal_3009Help
Entry
Nhal_3009         CDS       T01198                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nhl  Nitrosococcus halophilus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nhl00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nhl00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:nhl03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:nhl03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nhl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3082214..3082645)
Genome map
AA seq 143 aa AA seqDB search
MAKVDFYLLTSRQPQIRERFACKLTEKAYRLGHRIYIQVEDQEQAQKMDDLLWTFRQGSF
VPHALMNTEEASETPVLIGYGGEPESEMDLLINLCAEVPRFFSHFPRVAEIIDQDENNRH
AGRQRYRDYRDQGCSLETHELSI
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggttgatttttatttacttacgagccgtcagcctcaaatccgggagcgattt
gcctgcaagttaacggaaaaggcctatcggcttggccatcggatctatatccaggtggaa
gatcaggagcaagcgcagaaaatggacgacctcctatggaccttccgtcaaggtagtttc
gtcccccatgccctgatgaataccgaggaagcatccgaaacccccgtgctcattggctat
gggggcgaaccggagagtgagatggatctcttgattaatctctgcgcggaagtgccgcgg
tttttttctcattttccacgggtggcggaaattatcgaccaagatgagaacaatcgacat
gccggacggcaacgttatcgtgactaccgtgaccaaggttgttcactggaaactcacgaa
ctcagcatttaa

DBGET integrated database retrieval system