KEGG   Nitrosococcus halophilus: Nhal_3009Help
Entry
Nhal_3009         CDS       T01198                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nhl  Nitrosococcus halophilus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Nhal_3009
   00240 Pyrimidine metabolism
    Nhal_3009
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Nhal_3009
   03430 Mismatch repair
    Nhal_3009
   03440 Homologous recombination
    Nhal_3009
Enzymes [BR:nhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Nhal_3009
DNA replication proteins [BR:nhl03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Nhal_3009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3082214..3082645)
Genome map
AA seq 143 aa AA seqDB search
MAKVDFYLLTSRQPQIRERFACKLTEKAYRLGHRIYIQVEDQEQAQKMDDLLWTFRQGSF
VPHALMNTEEASETPVLIGYGGEPESEMDLLINLCAEVPRFFSHFPRVAEIIDQDENNRH
AGRQRYRDYRDQGCSLETHELSI
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggttgatttttatttacttacgagccgtcagcctcaaatccgggagcgattt
gcctgcaagttaacggaaaaggcctatcggcttggccatcggatctatatccaggtggaa
gatcaggagcaagcgcagaaaatggacgacctcctatggaccttccgtcaaggtagtttc
gtcccccatgccctgatgaataccgaggaagcatccgaaacccccgtgctcattggctat
gggggcgaaccggagagtgagatggatctcttgattaatctctgcgcggaagtgccgcgg
tttttttctcattttccacgggtggcggaaattatcgaccaagatgagaacaatcgacat
gccggacggcaacgttatcgtgactaccgtgaccaaggttgttcactggaaactcacgaa
ctcagcatttaa

DBGET integrated database retrieval system