KEGG   Nitrosococcus halophilus: Nhal_3052Help
Entry
Nhal_3052         CDS       T01198                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nhal_3052
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_3052
   00052 Galactose metabolism
    Nhal_3052
   00500 Starch and sucrose metabolism
    Nhal_3052
   00520 Amino sugar and nucleotide sugar metabolism
    Nhal_3052
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nhal_3052
   00524 Butirosin and neomycin biosynthesis
    Nhal_3052
Enzymes [BR:nhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nhal_3052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3125763..3126770
Genome map
AA seq 335 aa AA seqDB search
MKVLAADLGGTKTLLQVTRWTEETPQVLAERRYHSSGYPSFDVLLQEFLTEVGDIVSNLA
GACFAVAGPVAKGTAEVTNLSWRLEEECLQKGFGLPQVTLINDFQAIGYGIESLKPADFA
VLQAGVPEYAAPQAVIGAGTGLGQALLVWQEQAGHYQVLPTEGGHVDFAPRGELQIALLG
YLSRHLEHVSYERLLSGSGLVTLYRFLKETSGETEDLALKKALEEGDPAAAISRFALERR
DPLAGRALDLLARIYGAQAGNLALTCLPRGGLFVAGGIAPKIIECLQAGGFMEAFLSKGR
LSQLLRQIPVKVILEPKVGLWGASRVAARLANEKS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattggcggctgatctggggggaaccaagaccctgctccaggtgacccgttgg
acggaggagaccccgcaggttctcgcggagcggcgctaccatagcagtggttatccgagc
ttcgatgtccttttgcaagaattcttgacggaggtgggcgatattgtcagtaacctggca
ggcgcttgctttgcagtggcaggaccggtggcaaaaggcacggcggaggttaccaatctc
tcctggcggttggaggaggaatgtttgcaaaagggtttcgggttgcctcaagtgacctta
atcaatgatttccaggctattggttatgggattgaatccttaaaaccggctgattttgcc
gtgctccaggcgggagtcccggagtatgccgctccccaggcggtgattggtgccgggacc
gggcttgggcaggcactcctggtgtggcaagagcaagcaggtcactatcaggttttacct
accgaaggaggtcatgtagactttgccccccgaggagaacttcagattgccttgctgggt
tatctttctcgtcatctagaacatgtttcctatgagcgtctgttgtccggcagtgggctg
gtgactctctaccgtttccttaaggaaaccagtggcgagactgaagatctggccttaaaa
aaggcactagaggagggcgatccggcggcggctatcagtcgttttgccctggagcgtcgg
gaccctttagcgggccgagcattggatttgttggctcggatctatggcgcacaagcgggt
aatttggccctgacttgtttaccgcggggggggcttttcgtcgctggtggtattgctccc
aagataattgagtgtttgcaggcgggggggttcatggaggcctttctgagcaaaggacgg
ctatcccagctgttgcgacagattccggtcaaggtcatattggagcccaaagtcgggttg
tggggagcctcgcgagttgccgcgagattggctaatgagaaatcatga

DBGET integrated database retrieval system