KEGG   Nitrosococcus halophilus: Nhal_3052Help
Entry
Nhal_3052         CDS       T01198                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00010  Glycolysis / Gluconeogenesis
nhl00052  Galactose metabolism
nhl00500  Starch and sucrose metabolism
nhl00520  Amino sugar and nucleotide sugar metabolism
nhl00521  Streptomycin biosynthesis
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01120  Microbial metabolism in diverse environments
nhl01130  Biosynthesis of antibiotics
nhl01200  Carbon metabolism
Module
nhl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nhl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_3052
   00052 Galactose metabolism
    Nhal_3052
   00500 Starch and sucrose metabolism
    Nhal_3052
   00520 Amino sugar and nucleotide sugar metabolism
    Nhal_3052
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nhal_3052
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Nhal_3052
Enzymes [BR:nhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nhal_3052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADE16106
UniProt: D5BZ92
Position
3125763..3126770
Genome map
AA seq 335 aa AA seqDB search
MKVLAADLGGTKTLLQVTRWTEETPQVLAERRYHSSGYPSFDVLLQEFLTEVGDIVSNLA
GACFAVAGPVAKGTAEVTNLSWRLEEECLQKGFGLPQVTLINDFQAIGYGIESLKPADFA
VLQAGVPEYAAPQAVIGAGTGLGQALLVWQEQAGHYQVLPTEGGHVDFAPRGELQIALLG
YLSRHLEHVSYERLLSGSGLVTLYRFLKETSGETEDLALKKALEEGDPAAAISRFALERR
DPLAGRALDLLARIYGAQAGNLALTCLPRGGLFVAGGIAPKIIECLQAGGFMEAFLSKGR
LSQLLRQIPVKVILEPKVGLWGASRVAARLANEKS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattggcggctgatctggggggaaccaagaccctgctccaggtgacccgttgg
acggaggagaccccgcaggttctcgcggagcggcgctaccatagcagtggttatccgagc
ttcgatgtccttttgcaagaattcttgacggaggtgggcgatattgtcagtaacctggca
ggcgcttgctttgcagtggcaggaccggtggcaaaaggcacggcggaggttaccaatctc
tcctggcggttggaggaggaatgtttgcaaaagggtttcgggttgcctcaagtgacctta
atcaatgatttccaggctattggttatgggattgaatccttaaaaccggctgattttgcc
gtgctccaggcgggagtcccggagtatgccgctccccaggcggtgattggtgccgggacc
gggcttgggcaggcactcctggtgtggcaagagcaagcaggtcactatcaggttttacct
accgaaggaggtcatgtagactttgccccccgaggagaacttcagattgccttgctgggt
tatctttctcgtcatctagaacatgtttcctatgagcgtctgttgtccggcagtgggctg
gtgactctctaccgtttccttaaggaaaccagtggcgagactgaagatctggccttaaaa
aaggcactagaggagggcgatccggcggcggctatcagtcgttttgccctggagcgtcgg
gaccctttagcgggccgagcattggatttgttggctcggatctatggcgcacaagcgggt
aatttggccctgacttgtttaccgcggggggggcttttcgtcgctggtggtattgctccc
aagataattgagtgtttgcaggcgggggggttcatggaggcctttctgagcaaaggacgg
ctatcccagctgttgcgacagattccggtcaaggtcatattggagcccaaagtcgggttg
tggggagcctcgcgagttgccgcgagattggctaatgagaaatcatga

DBGET integrated database retrieval system