KEGG   Nitrosococcus halophilus: Nhal_3378Help
Entry
Nhal_3378         CDS       T01198                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
nhl  Nitrosococcus halophilus
Brite
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Nhal_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3477796..3480471)
Genome map
AA seq 891 aa AA seqDB search
MRIHFEPNLKHQSEAVSAIVRVFEGAPYTRPEERFWSGEVSSNILKLPAEYWQANVAAIA
AENGIEDYAPTSERDFTIEMETGTGKTYVYLRTIFELHRRYGLHKFIIVVPSVAIREGTL
AQLCLTKGHFREIYATEAEVTEYDSKNLTQVRSFCVSNHLSIMVMNKQAFDSDAKIINDE
NRDGGNLMEMLRQVQPIIIMDEPQEGMDTPNMQARIAAFNPLFKLRYSATHRELKNIIYR
LTPFDAYNRGLVKKIAVLSIHETNTQSNVAIEFRKLNLSAADPTARLQLNVRLKGGDLKA
KLITVKRGDDLEKKTGNPVYHGWIVEDIGTTDLYGGEGYVKFTNGEQIGEGAKHGSDQEA
IFREQIRRAIHNHFERKKQLVPIGIKPLALFFIDRVANYMDEDGLIRRLFLEEYQAFYRK
AHKEDPPNAHEVHGGYFAKTSSGDYTDNAKSMATNAEIYEKILKAKEALLSFDEPLEFIF
SHSALGVGWDNPNVFTICTLNETESIIKKRQEIGRGLRLCVDQQGRRYRDPESVKENEEV
NLLTVVANQSYYAFVSSYQEELHEELGIHAKAPPVRDNNRKLVKLHLNSERFTSDDFKNL
WKRIARKTRCRVHFREDELIEKSIAALADIAVDENRLEVSLTYWSRMTEADGIEGQGKGS
TRAALSPHLSRVDVVDEFARNTALSDVTAASILDGMAEVQKRQLAKNPMQFLAEATKKVR
RVLEREMVRLVKYEPIEESHPLDLFETVIETKRETTATPKHGLYDRIIHDSDVEKHFAGE
LDNHHAVRVLIKLPASYKIPTPIGNYNPDFALVIEKKDLDNPAAEQRFYFTVETKGTTEW
EKLKSDEKLKIECAVKHFEAIGLAAYLAPVDSLKSFDTRARERIGQTFFDM
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgagaatccacttcgagcccaatctaaagcaccagagtgaagccgtttcggcgattgtt
cgtgtatttgagggtgcaccctatacacggccagaagagcgcttttggagcggtgaagtt
tccagcaatatcctgaagttacccgccgaatattggcaggctaatgttgctgccattgcc
gctgagaatggcatagaggattatgcaccgaccagcgagcgggattttaccattgagatg
gagaccggcacggggaaaacctacgtctatctccgcaccatctttgaattgcaccggcgc
tatggcttgcacaagttcattatcgtcgtaccgagcgtagcgatccgcgagggcacactg
gcccagctatgcctcaccaaagggcatttccgggaaatctacgcaaccgaagccgaagtc
actgagtatgatagcaagaatctgactcaggtgcggagtttctgcgtctccaatcatctt
tccatcatggtcatgaataagcaggccttcgacagcgatgccaagatcatcaatgacgag
aaccgagacggcggtaatttaatggagatgctgcgccaggtgcagccgatcatcattatg
gatgagccgcaggagggcatggacacccccaatatgcaggcccggatcgccgccttcaat
ccgctgtttaagctgcgctattctgccacccaccgcgaactaaagaacattatttaccgc
ctcactcccttcgatgcgtacaatcgtggactggtgaaaaagattgccgtgctctcgatt
cacgagacgaatacgcaaagcaatgtagccatagagttcagaaagcttaacctgagcgcg
gccgatccaactgcccggctacagcttaatgtccgcctgaagggcggcgatctcaaagcc
aagcttatcactgtgaagcgtggcgacgacctggagaaaaagaccggcaaccctgtctac
catggctggattgttgaggatattggcaccaccgatctctacggtggtgaaggctatgtg
aagttcaccaacggtgagcagatcggtgaaggcgcaaagcatggcagcgatcaggaagct
atctttcgcgagcaaattcgccgcgccatccacaatcattttgagcgcaagaagcagctt
gtaccaataggcatcaagcctcttgccctgttctttattgaccgtgtggccaactatatg
gatgaggacgggctgattcgccgcctgttcctggaagaatatcaggcgttctaccgtaag
gcccataaagaagacccgcccaatgctcatgaagtgcatggtggttatttcgctaagact
agcagcggcgattacaccgataacgccaagtccatggcgaccaatgctgaaatttacgaa
aaaattctaaaggctaaggaagccttgctttcctttgatgagccccttgagttcattttc
tcgcactcggccttgggggtagggtgggacaacccgaatgtcttcactatctgcaccttg
aatgagactgaaagcatcatcaagaagcggcaggagatagggcggggccttcgcctgtgc
gtcgatcaacagggcaggcgctatcgtgatccggaatcggtgaaagaaaacgaggaagtg
aacctgctcactgttgtagccaatcagagctattatgctttcgtcagtagctatcaagag
gagctgcatgaagagcttggtattcatgccaaagcgccgccggtgcgcgacaataatcgc
aaacttgtaaaacttcatctcaattctgagcgttttacctcagacgactttaagaatctt
tggaagcggatcgcccgtaaaacccggtgccgggtgcatttccgggaagacgagttgatc
gagaaaagtattgccgccctggcggatattgccgtggatgagaaccggttggaagtgtca
ttgacctactggagccgaatgactgaagcagacgggatcgaggggcaagggaaaggctca
acccgtgctgctcttagtccgcacctttccagggttgatgtggtggacgaattcgcccgg
aatacggctctatctgacgtgacagccgcctccattctagatgggatggcagaggtgcag
aaacgccagcttgccaagaaccccatgcagtttcttgccgaggccactaaaaaagtgcgc
cgggtgctggaacgggaaatggtgcggttggtgaaatacgagccgattgaggaatctcac
cctctcgacctgttcgagaccgtgatcgagaccaaacgggaaactacagccacgccgaag
catggcctctatgatcgtatcatccatgattccgacgtggagaagcacttcgccggtgaa
ctcgacaaccaccatgcagtgcgtgtccttattaaactaccagccagttataaaatcccg
acaccaatcgggaactataaccccgattttgcactggtgattgaaaaaaaggacttggat
aatcctgccgctgagcagcgcttttattttactgtagagaccaaaggtactaccgaatgg
gagaagctaaaatctgatgaaaagctaaagattgaatgtgcggtgaagcacttcgaggcc
attggccttgcggcctatctggccccggtggatagcttgaagagcttcgatacccgcgcc
cgtgagcgcatcggccagactttttttgatatgtaa

DBGET integrated database retrieval system