KEGG   Nitrosococcus halophilus: Nhal_3702Help
Entry
Nhal_3702         CDS       T01198                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nhal_3702
   01230 Biosynthesis of amino acids
    Nhal_3702
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_3702
   00051 Fructose and mannose metabolism
    Nhal_3702
   00562 Inositol phosphate metabolism
    Nhal_3702
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nhal_3702
Enzymes [BR:nhl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nhal_3702
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nhal_3702
  Exosomal proteins of bladder cancer cells
   Nhal_3702
  Exosomal proteins of melanoma cells
   Nhal_3702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3814983..3815735)
Genome map
AA seq 250 aa AA seqDB search
MRKPLVVGNWKMNGLRATNRPLLESVREGVDAGVAAEVAVCPPFVYLADAASLLQGSAVS
WGAQNLSQHETGAYTGEVAPSMLRDLDCRFVIVGHSERRALYGETDSLVAEKVVAAQGAE
LTPIICLGESLEEREQAVTEQVVKRQLDAVLERVGVDALSKAVIAYEPIWAIGTGRTATP
EQAQEVHGLIRAHVATQNSNIAEELLILYGGSVKGNNAAQLLAMPDIDGGLIGGASLNAE
EFLTICQAAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaacccctagtcgttggtaattggaagatgaatggtttgcgggcgaccaatcgc
cccctcttagaatctgtgcgtgagggggtggacgctggggtggctgcagaagtggcggtt
tgtccgccttttgtgtatcttgccgatgcggcgtccttgctccaagggtcggctgttagc
tggggcgctcaaaatttatcccagcacgaaacgggagcctatactggagaagttgcccct
tctatgctaagggatttagattgtcgttttgtcattgtgggccattctgaaagacgcgcc
ctgtatggggaaaccgatagcctcgtggctgagaaagtagtcgccgcccaaggggcggag
cttaccccgatcatctgccttggggaatccctggaagagcgtgagcaggctgttaccgag
caggtggtgaaacgtcagctcgatgctgttttggagcgggtcggcgtcgatgccctgagt
aaggccgttatcgcctatgagcccatatgggcgattggtactggccgtaccgcaaccccc
gagcaagcccaagaggttcatgggcttatccgtgcccatgtggctactcagaactccaat
atagctgaggaattgcttatcctctatggtggtagtgttaaggggaacaatgcggcgcaa
ttattggcaatgcccgatatcgatggtggcttgattggcggggcctcattgaatgccgag
gaattcttgacaatctgccaagcggcaggctaa

DBGET integrated database retrieval system