KEGG   Nitrosococcus halophilus: Nhal_3711Help
Entry
Nhal_3711         CDS       T01198                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nhl  Nitrosococcus halophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nhal_3711
Enzymes [BR:nhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Nhal_3711
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nhal_3711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3826580..3827674
Genome map
AA seq 364 aa AA seqDB search
MRKRDDSYRFLWDDLFSTGHNRRILVLSTRLWNSRSFPRARPRRMRRDDFSRRLMREARL
NCDDLIYPVFVLDGHSRREAVPSMPGIERVTIDALLDEAEALITLGIPAIALFPVTSPDR
KSDDAREAYNPEGLAQRAVRALKQHLPHLGVITDVALDPFTSHGQDGLVDAQGYVINDET
VEVLVKQALSHAEAGADIVAPSDMMDGRIGAIRQALESAGYLNTRILAYSAKYASSFYGP
FRDAVGSANNLGGGDKYSYQMDPANSDEALQEIALDLEEGADMVMVKPGMPYLDIVRRVK
TTFGVPTMVYQVSGEYAMLTAAAQNGWLERQAVVMESLVSMKRAGADAILTYFAKDAARW
LHNQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcgtgatgacagctaccgcttcctatgggatgatttattttccactggacat
aataggaggattttagtcttgtcgacacgcctttggaatagtcgatcttttccccgcgcc
cgcccccgccgcatgcggcgggatgatttttctcggcggttgatgcgggaagcccgtcta
aactgtgacgatcttatctatccggtgtttgtcctcgacggccacagccgccgcgaggcg
gtcccttctatgccgggcattgagcgagtcaccatcgatgctttactggatgaagcggaa
gcgctcatcaccttgggtatccctgccatcgccctgttccccgtgacctcaccggatcgg
aagtcggacgatgcgcgcgaagcctataatccagagggtctcgcccagcgggcggtacgg
gctttgaaacagcatcttccccatctgggcgtgatcactgatgtggccctagaccccttt
accagccatggccaggacggccttgtcgatgcccagggttatgtcatcaacgatgaaacg
gtcgaggttctggtaaagcaagccctttcccatgcagaagctggcgctgatattgtcgcc
ccctccgacatgatggacggccgtattggtgccattcgccaggcgctggaaagtgctgga
tacctcaatacccggattcttgcctactcggctaaatacgcttccagcttttatgggcct
ttccgggatgcggtcggatcggcgaataacctggggggtggcgacaagtacagctaccaa
atggatccggctaacagtgatgaagcgctgcaagaaattgctttagacttggaagagggc
gcggatatggtcatggtcaagccaggaatgccttacctcgatatcgtccggcgggtgaaa
acaacctttggcgtccccaccatggtgtatcaggtcagcggcgaatatgccatgctgact
gctgctgcccagaatggctggctggaacggcaagcggtggtgatggaatcgctggtttcc
atgaagcgagccggggctgatgccatcttaacctactttgccaaagatgccgcgcgctgg
ctacataaccaatag

DBGET integrated database retrieval system