KEGG   Nitrosococcus halophilus: Nhal_3733Help
Entry
Nhal_3733         CDS       T01198                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nhl  Nitrosococcus halophilus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nhl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3849239..3849838
Genome map
AA seq 199 aa AA seqDB search
MNLFGPSLGRLVEALRCLPGVGPKSAQRMAFHLLESDREGGQRLAQALLEALGKITHCQA
CRILSETDLCPLCADPQRDHSQLCVVEMPSDVQAIEQATAYPGVYFVLMGHLSPLDGIGP
EALGMDLLAKRLDTDQIRELILATNLTVEGEATAHYLSELARSRGITVSRIAHGVPLGGE
LEFVDRGTLSHAFQGRHHL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttatttggtccttcactagggcgcctcgttgaagccctgcgctgcctccccggc
gttggccccaaatctgcacaacgcatggcctttcacttgctggaatctgaccgggaaggg
ggccaacgcctagcccaggcattgctggaagcccttggcaaaattactcactgccaggca
tgccgtatcttaagcgaaactgatctgtgtcccctctgcgctgatccccaacgggatcat
agccaactctgcgtcgtagagatgcccagcgatgttcaagccatcgaacaggccacggcc
tatcccggtgtgtactttgtcttaatgggccatctctcacccctggacggcattggtccc
gaggccttagggatggacttattagcaaaacgcttagacacagatcagattcgcgaactt
atcctagcgactaatctcaccgtcgaaggtgaagcaacagcccattacctcagtgaattg
gcacgaagccgcggtatcaccgtaagtcgcatcgcccatggggttcctctaggcggcgaa
cttgaatttgttgatagaggcaccctatcccatgctttccaaggccgacaccatttataa

DBGET integrated database retrieval system