KEGG   Nitrosococcus halophilus: Nhal_3802Help
Entry
Nhal_3802         CDS       T01198                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_3802
   00030 Pentose phosphate pathway
    Nhal_3802
   00051 Fructose and mannose metabolism
    Nhal_3802
   00052 Galactose metabolism
    Nhal_3802
   00500 Starch and sucrose metabolism
    Nhal_3802
   00520 Amino sugar and nucleotide sugar metabolism
    Nhal_3802
  Nucleotide metabolism
   00230 Purine metabolism
    Nhal_3802
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nhal_3802
Enzymes [BR:nhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Nhal_3802
    5.4.2.8  phosphomannomutase
     Nhal_3802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3914828..3917326)
Genome map
AA seq 832 aa AA seqDB search
MESLAVKFPFFNRQKQAKEGQALGHYTLAAFLAAGLVFAGLALLFYQQWLLSSEQQLSKH
IQLEVQRQAAAVHAKIRAYGQTLASMARNPVLLRLIEEGDKRLLQVKERELRYAFPGAVR
VRLLPPGVSDVDEQSVPPLSYSTLALLRTAESSDRATLAEVQLLGRPEQYVAMAHRIPSP
NGEVAGILFLALDPSVFANVLSRLGLSDSYLELRQGTNQRQVFARYGNGQLASHPPQGLI
PIEESRWQLAYWLSAPGESESAHLMFWGGVAAGLLILGLIFYARDRVFAHLLRGDLITLV
NLVRDLQRGQPQDRYKVHLADFKGAVAVIQRMTSEEQGEGEAVVPAAASSGNAISDVVFE
ATEGMKVEEQLPKQGGPIAASIFKAYDIRGVVGETLTSETVYEIGRAIGSEAHAQGQQNI
IVGRDGRLSGPDLSHSLIEGLRATGREVVNIGVVPTPLLYFATQYLSTGSGVMLTGSHNP
PNYNGMKIMLRGETLALDAIQALRRRIESGDYTSGTGDLQAVDVVPDYIERVTSDVKLIR
PLKIVVDCGNGAAGEVAPRLFRALGSEVIELYCEIDGQFPHHHPDPSQSENLEDLINKVK
EEGADLGLAFDGDGDRLGVIDSQGRIIWPDRQLMLYAMDVLSRHPGATILYDIKCSRHLD
QIITEYGGSPLMWKTGHSLIKAKMRETGALLAGEMSGHLFFKERWFGFDDALYAGARLLE
ILAADTRTSGEVFAALPEAVSTPELRVEMAEGEHFRFMERLLHQAQFPDAAVTTIDGLRV
DFEEGWGLVRPSNTTPCLVLRFEANDGEALECIKDTFRRLLLEVDPSLALPF
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggaatctttggcggttaagtttcccttctttaacaggcaaaagcaggctaaagagggg
caggccttggggcactatactctggccgcttttttggccgcagggttagtcttcgcgggt
ttggcgctgcttttttatcaacaatggttgctttcctctgagcagcaactcagtaaacat
attcagttggaggttcaacgccaagcggcggcggtccatgcgaagattcgtgcttatggg
caaacccttgcttccatggcccgtaatcctgtccttctgcgcttaatcgaggagggagat
aagcggttattgcaggtcaaagaacgggaattgagatatgctttccctggggcggtacgg
gttcggctgctacccccgggggtaagtgatgtcgatgagcaatcggtgccgccactgagt
tactccacgctagccttgttgcgaacggcagaaagcagcgacagggcaacgcttgccgag
gtgcagttgctaggccgcccggagcaatatgtggccatggcccaccgcatcccgtcaccg
aatggggaggtggcgggaattctcttcttagcccttgatcccagcgtgtttgcaaacgtt
ctaagccggttaggtttatcggacagttatctggagctgcgccagggcaccaatcagcgc
caggtctttgccaggtatggaaatgggcaattagcgagtcatccaccccaagggcttatc
cctattgaggaaagtcgctggcagttggcctactggttatccgccccaggggaaagtgaa
agcgcccacctaatgttttgggggggagtggctgctggattgctaatattaggccttatt
ttttatgcccgagaccgggtatttgcccatcttttgcggggcgatcttatcacgctagtt
aatctggtccgtgacctccaaagaggccagccgcaggaccgctataaagtccatttagcc
gattttaaaggggcagttgccgttattcagcgtatgacctcggaagagcagggggaaggg
gaagccgtagttcctgccgcggcttctagcggcaatgccatcagtgatgtggtttttgag
gcaacagagggcatgaaggtggaagaacagcttcctaagcagggcggtcctatcgccgcc
tctatttttaaagcctatgacattcgcggcgtggtgggagagaccctcacttcggagacc
gtttatgagattgggcgggccattgggagtgaggcccacgctcagggtcagcaaaacatt
atcgtgggtcgggatggtcgcctctccggtccggatttgtcccatagtctcattgagggg
cttcgggcaaccggccgagaggtggttaatattggcgtggtgccgactcccctattgtat
ttcgcgactcaatatctgagtacgggttcaggggtgatgctaacagggagccataatccc
cctaactataacggcatgaaaatcatgcttcgtggtgagacgcttgcgctagatgccatt
caggcgctgcggcgccgaatcgagtcgggggattacaccagcggtacaggagatttgcag
gcggtggatgtggtgcctgattacattgagcgggtaaccagtgatgtaaaactcattcgc
cccctgaaaattgtagtggattgtgggaatggggccgccggcgaggtggccccccgtctc
tttcgggctctcggcagcgaggtcatcgaattgtattgcgagattgatggccaattcccc
caccaccatcccgatcctagccaatcagagaatttagaggatctcatcaacaaggtaaag
gaagagggagccgatttagggctagccttcgatggggatggagatcgtttaggggttatt
gattcccagggccgcattatttggcccgatcgccagctcatgctctatgcgatggatgtc
ctctcccggcatccaggagccaccatcctttacgacattaaatgctctcgccacttagat
cagatcatcaccgaatatggggggagtccgctgatgtggaaaaccgggcactcccttatc
aaggctaagatgagagagaccggtgcccttttggcgggtgaaatgagcggccatctcttt
ttcaaggaacgctggtttgggtttgacgatgccctctatgccggggctcggctattggag
attttagcggccgatacccggacttcgggggaagtatttgctgccttgccagaagcggtc
agtacgccggagttacgggtagagatggccgagggggaacattttcgatttatggaaaga
ttattacaccaagcccagttcccagatgctgccgtgactaccattgatgggctgcgggtg
gattttgaggagggttggggcctggtccgtccttctaacaccaccccttgcctggtgtta
cgtttcgaagccaatgatggcgaggctttagagtgcattaaagacacttttaggcgcttg
ctgctagaagttgaccctagcctagcactgccgttttaa

DBGET integrated database retrieval system