KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0076Help
Entry
Nit79A3_0076      CDS       T01569                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Nit79A3_0076
Enzymes [BR:nii01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Nit79A3_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(91049..92002)
Genome map
AA seq 317 aa AA seqDB search
MHTWDNGFRGKPGQGMSHTLSFGGAASFFRVPYQTDLTGVDVAVIGVPMDIATTNRSGAR
LGPRAIRNASLSLAWERPWPWQTDAMTALRVIDYGDCEPVDGDLLSVSHIEKHIANIVTS
GTAALVLGGDHFVAYPSLRAHAAAYGPISLIHFDAHTDTWPYSGNGINHGTMFHQAALEK
IIEAASSTQIGIRTTNEDTMGFHIVSAADVHETSGRDIARQIRERVGNSPVYITFDIDCL
DPAFAPGTGTPVPGGLSTFQALNIIRELKGINLVGMDVVEVAPAYDHAEITALAAAQIAI
ELLCLYAESHTQRKKSR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcatacttgggataatgggtttcggggtaaaccgggacagggcatgtcgcatacctta
agtttcgggggagcagccagtttttttcgtgtgccttaccaaacagatctgacaggggtt
gatgtggctgtaatcggagtaccgatggacattgctaccaccaatcggtccggtgcgcga
ctggggcctcgcgccatccgtaatgcgtcgttgtcgctggcgtgggaacgcccgtggcca
tggcaaacggatgcgatgactgcactacgtgtgattgattacggtgactgcgagcccgtt
gacggggatttgttgagcgtgtcccatatcgaaaaacatatcgccaatattgtcacctcg
gggacagcagcgctggtactcggcggagatcattttgtcgcttatcctagcttgcgggct
catgccgccgcgtatggtcctattagtctgattcattttgatgcccataccgatacatgg
ccttactccggcaatggcataaatcacggcaccatgtttcaccaggctgcgctggaaaag
attatagaagccgcatcgtccacacaaattggtatccggaccactaatgaagacacgatg
ggtttccatattgtttccgcggcagatgtgcatgagacgtccggtcgcgacatagctcgg
caaatacgtgagcgggtaggaaattcgcctgtgtatatcacctttgacatagattgcctg
gatccggcttttgcacctggcactggcacgccggtaccgggtggattatcaacctttcag
gcgttgaacattattcgtgaactcaaaggcatcaatctggtgggtatggatgttgtcgag
gttgcacccgcttatgatcatgctgaaattactgcacttgcggccgcgcagatcgctatt
gagttgttatgtctttacgctgaaagtcacacacagcgaaaaaaatcccgatga

DBGET integrated database retrieval system