KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0083Help
Entry
Nit79A3_0083      CDS       T01569                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Nit79A3_0083
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Nit79A3_0083
Enzymes [BR:nii01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Nit79A3_0083
Lipid biosynthesis proteins [BR:nii01004]
 Desaturase
  First
   Nit79A3_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97202..98392)
Genome map
AA seq 396 aa AA seqDB search
MQQFMQLGLFELPWWGYALVTLIMTHMTIASVTIFLHRHQAHHALTLHPIVSHCFRFWLW
LTTGMITKEWVAIHRKHHAKCETVEDPHSPQIHGIGKVLFEGTKLYCIEAKNTATLDKYG
HGTPDDWVERHVYSPHPALGIGIMLAIDLVLFGPVGFIVWGVQMLWIPLFAAGVINGVGH
YYGYRNFSPNDTSTNILPWGILIGGEELHNNHHAYVTSAKLSSKWWEFDIGWMYIRILEM
LGLATVCKVAPKVRFSLPKTPCDEGTLQAVITHRFDVLAKFAKYLKQPTISEIRNLRAQA
IPGLQDAQALEAVRHWLQNDISKIAEKERVALDQALHSSQKLSTIYSMRQDLAALWSSST
TSKEQLVKQLENWCRRAEESDISALQEFSQKLRCYD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatttatgcaacttggcttatttgaacttccgtggtggggttatgcgttggtt
acgctaatcatgacacacatgaccatcgcttccgtgacgattttcctccaccggcaccag
gcgcaccatgcgctaacgctgcatcccattgtgagccactgcttccgcttttggctatgg
cttaccaccggaatgatcaccaaagaatgggtagctattcatcggaagcaccatgccaag
tgcgaaaccgtcgaagatccgcacagcccgcagattcatggcatcggcaaagtgttgttc
gaaggcactaagctttattgtatcgaagctaagaataccgcaacgctcgataaatacggc
catggcactcccgatgactgggtcgagcgccatgtatactcgccgcatccggcactgggt
atcggcatcatgttggcgattgatctggtgctattcggtccggtcggattcatcgtatgg
ggcgtgcagatgctgtggattccactcttcgccgccggcgtcatcaacggtgtagggcac
tattacgggtatcgcaatttctcaccgaatgacacttccacgaacatcctgccatggggc
attttgatcggcggcgaagaactgcacaacaatcaccatgcctacgtgacttccgccaag
ttgtccagcaaatggtgggaatttgatatcggctggatgtacattcgcattctggaaatg
ctgggcttggccacggtatgtaaggtggcacctaaggttcgctttagtctgcctaagacg
ccctgcgacgagggaactttgcaggccgtgatcacccaccgcttcgacgtgctggccaag
tttgcaaaatacctgaagcagcccacaatatccgagattcgcaatctgcgtgcgcaagct
attccgggtctgcaagatgcacaggccctcgaggcagtcaggcattggctgcaaaatgat
atcagtaagatagcggaaaaagaacgggtggccttggaccaggcgctccattccagtcag
aaactaagtacgatctactcaatgcgacaagatctggccgccttatggagcagttccacg
acctccaaagagcagctggtaaagcaactggaaaactggtgccggcgtgccgaggagagc
gacatcagtgcattacaagaattctcccaaaaactacgttgttacgactaa

DBGET integrated database retrieval system