KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0128Help
Entry
Nit79A3_0128      CDS       T01569                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nit79A3_0128
Enzymes [BR:nii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Nit79A3_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
151921..152715
Genome map
AA seq 264 aa AA seqDB search
MLANKQLDGINILVTRPIHQSVFLAEGIRAIGGNPILLPVLEITDVKDLNPLLDLIGRLD
EFDWAIFVSPNAVNKAMQLIGKQRILPSHLRFAAVGKGSADALKHYGINEVLVPVEHFDS
EALLQQEQLQNMAGKRVVIFRGNGGRELLGDTLIQRGALLEYAECYQRRKPDIDTTSLIA
AWSQGEIHAVIITSSEGLHNLFDIIGKLGQQLLKSTPVFTTHERIARTAKELGLGKIVKA
MSAGDEGLLESLQAYFKVTGKYTV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgcaaataaacagttagacggtattaatattctagttactcgtccaatacatcaa
tcggtttttctggcagaaggtattcgcgctatcggtggtaatccaattctacttccggta
ctcgaaataactgatgtaaaagatttaaatccattactagatctaattggccgcttagat
gaattcgattgggcgatatttgtcagtcctaatgctgtcaacaaagcaatgcagttaata
ggcaagcaacgtatattgccatctcatttgagatttgccgctgtcggtaaaggcagtgca
gatgctttaaagcattatggcatcaacgaggtactcgttccagtcgagcattttgatagt
gaagcattactgcagcaggagcaattgcaaaacatggctggcaaacgggttgttattttt
cgtggtaacggtggcagggagttactgggagatacgctcattcagcgtggcgcacttctc
gaatacgcagaatgctaccagcgcaggaagccagatatcgatactacgtcactaattgct
gcttggtcgcaaggcgagatacacgccgtgattatcacgagcagcgaaggattgcataat
ttatttgacataataggcaagcttggccaacaattactgaaatcgaccccggtttttaca
actcatgaacgcatagcccggacagcgaaagaattggggctgggaaaaatcgtaaaagct
atgtctgctggagatgaaggtttgctggaaagcctgcaagcgtactttaaggtaaccggg
aaatatacagtttag

DBGET integrated database retrieval system