KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0211Help
Entry
Nit79A3_0211      CDS       T01569                                 

Definition
Disulfide bond isomerase, DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nii  Nitrosomonas sp. Is79A3
Brite
Enzymes [BR:nii01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Nit79A3_0211
Secretion system [BR:nii02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Nit79A3_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
245059..245781
Genome map
AA seq 240 aa AA seqDB search
MTMRLKLFISILVFGFFSGAVWADEAALRKAIQPHFADSKIESVKKTPYLGLYEVVVGDE
VFYTDDKADYFFFGHVIDTKTRTSMTNERIQEIKAARRVPLDSLPLQSAIKVVKGDGKRR
VAIFTDPNCPYCKQLEKELLNVTNVTIYTLLYPVLKGSMELSKKIWCSDNQIKAWDDFML
KNVAPSSKDCETPLDALVKSGHENKVSGTPTLIFADGSVVGGMIPATVIEEKLENASKSK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactatgcgcttgaagcttttcatttcaatcttggtatttggtttcttttctggagct
gtttgggctgatgaagcagctttaagaaaggccattcaacctcattttgcggatagtaaa
attgagagcgtgaagaaaacgccttatctgggattgtatgaagtggttgtcggtgatgag
gtattttataccgatgataaggccgattatttcttctttggtcatgtgatcgacaccaag
acccggacgagcatgaccaatgaacggatccaggagatcaaggctgctcgacgagttccg
ctagattctttgccgttgcaatcggctataaaggtcgtgaaaggcgatggcaagcggcgg
gtggcgatttttaccgatcctaactgcccatactgcaagcaattggaaaaagagttgctc
aatgtgacgaatgtgacgatctataccttgctctatccggtgctcaaaggatctatggaa
ttatccaaaaagatctggtgttcagataatcaaattaaagcttgggatgattttatgctg
aagaatgttgcgccatcgagtaaagattgcgaaacgcctctggacgcactggtgaagtct
ggtcatgagaataaagtgagcggtacgccaacactgatttttgctgatggctcagttgtg
ggcggtatgattccggcaacagtgattgaggaaaaactggagaacgcaagtaagagcaaa
taa

DBGET integrated database retrieval system