KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0235Help
Entry
Nit79A3_0235      CDS       T01569                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_0235
   00030 Pentose phosphate pathway
    Nit79A3_0235
   00051 Fructose and mannose metabolism
    Nit79A3_0235
   00052 Galactose metabolism
    Nit79A3_0235
  Energy metabolism
   00680 Methane metabolism
    Nit79A3_0235
Enzymes [BR:nii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Nit79A3_0235
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Nit79A3_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(273944..275203)
Genome map
AA seq 419 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASAAGVLETARQHSDKIGNVYAGRNGIIGALTEDLIDTNAD
SAAAIAALRHTPSGAFGSCRYKLKSLEQNRREYERLIEVFKAHNIGYFFYNGGGDSADTC
LKVSQLSDTLGYPLQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTREASFDVASMSKT
STKVFVLEVMGRHAGWIAAAGGLASSPDCEIPIIILFPEITFNKEKFLAKVDRYVKEYGY
CSVVVSEGVKGEDGNFLSDQGLRDAFGHAQLGGVAPVVANIIKDGLGLKYHWGVADYLQR
AARHIASKTDVEQAYAMGKAAVEYAIAGHNSVMPTIVRQSNAPYSWTVGMAKLANVANVE
KMMPADYISEDGFGISQACRKYLSPLIEGEDYPPYKNGLPDYVRLKNVAVEKKLGEFKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaaaatgcattttatgcccaatccggcggcgtaacggctgtaatcaacgct
tcggccgcgggtgttctagaaacagcgcgccagcactctgataaaattggcaatgtctat
gcaggtcgcaatgggattatcggtgcgttgaccgaagatttgattgataccaatgctgat
tcagcagcagcgattgctgcgctacgtcataccccgtcaggtgcatttggatcgtgccgc
tacaaattaaagagcttggagcaaaatcgacgcgaatacgaacgtctgatcgaagtattc
aaagcgcataatattggttatttcttttataatggcggcggtgattctgcggatacctgc
cttaaggtttcacaattatccgatacgctcggctatccccttcaggcgattcacgttccc
aaaacggttgacaacgatttgccaatcacagattgttgccctggttttggctctgtcgcc
aaatatatcgcggtatccacacgcgaagcgagctttgatgtagccagcatgtctaaaaca
tcaactaaagtttttgttctggaagtgatgggccgccacgcaggatggattgccgcagcg
ggcggattggcttcgagtccagattgtgaaattccaataatcattttgtttccagaaatt
acattcaacaaagaaaagtttcttgccaaagtggatcgctatgtcaaggaatatggctat
tgctcagtcgtcgtatctgaaggtgttaagggggaagatggtaattttctttccgaccag
ggactgcgtgatgcctttgggcatgcacaactaggcggcgttgcaccggtggtagccaat
atcatcaaagatggtttgggattgaaatatcattggggtgttgctgattatctacagcgt
gctgcacggcacattgcttccaagaccgatgtggaacaagcttatgcaatgggtaaagcg
gcagtggaatatgctattgcaggacataactcagtcatgccaacgatagttcgtcaatcc
aatgcaccttatagctggacggtgggcatggctaagcttgctaatgtagccaatgtcgag
aaaatgatgccggctgattatatcagtgaagacggatttggcattagtcaggcttgccgc
aaatacttatcgccactgattgagggtgaagattatccaccttataaaaatggattgcca
gattatgtgcggttaaaaaatgtagcggttgagaagaaattgggcgagttcaaaatttaa

DBGET integrated database retrieval system