KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0235Help
Entry
Nit79A3_0235      CDS       T01569                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00010  Glycolysis / Gluconeogenesis
nii00030  Pentose phosphate pathway
nii00051  Fructose and mannose metabolism
nii00052  Galactose metabolism
nii00680  Methane metabolism
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01120  Microbial metabolism in diverse environments
nii01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_0235
   00030 Pentose phosphate pathway
    Nit79A3_0235
   00051 Fructose and mannose metabolism
    Nit79A3_0235
   00052 Galactose metabolism
    Nit79A3_0235
  Energy metabolism
   00680 Methane metabolism
    Nit79A3_0235
Enzymes [BR:nii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Nit79A3_0235
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Nit79A3_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEJ00142
UniProt: F8GGI3
Position
complement(273944..275203)
Genome map
AA seq 419 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASAAGVLETARQHSDKIGNVYAGRNGIIGALTEDLIDTNAD
SAAAIAALRHTPSGAFGSCRYKLKSLEQNRREYERLIEVFKAHNIGYFFYNGGGDSADTC
LKVSQLSDTLGYPLQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTREASFDVASMSKT
STKVFVLEVMGRHAGWIAAAGGLASSPDCEIPIIILFPEITFNKEKFLAKVDRYVKEYGY
CSVVVSEGVKGEDGNFLSDQGLRDAFGHAQLGGVAPVVANIIKDGLGLKYHWGVADYLQR
AARHIASKTDVEQAYAMGKAAVEYAIAGHNSVMPTIVRQSNAPYSWTVGMAKLANVANVE
KMMPADYISEDGFGISQACRKYLSPLIEGEDYPPYKNGLPDYVRLKNVAVEKKLGEFKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaaaatgcattttatgcccaatccggcggcgtaacggctgtaatcaacgct
tcggccgcgggtgttctagaaacagcgcgccagcactctgataaaattggcaatgtctat
gcaggtcgcaatgggattatcggtgcgttgaccgaagatttgattgataccaatgctgat
tcagcagcagcgattgctgcgctacgtcataccccgtcaggtgcatttggatcgtgccgc
tacaaattaaagagcttggagcaaaatcgacgcgaatacgaacgtctgatcgaagtattc
aaagcgcataatattggttatttcttttataatggcggcggtgattctgcggatacctgc
cttaaggtttcacaattatccgatacgctcggctatccccttcaggcgattcacgttccc
aaaacggttgacaacgatttgccaatcacagattgttgccctggttttggctctgtcgcc
aaatatatcgcggtatccacacgcgaagcgagctttgatgtagccagcatgtctaaaaca
tcaactaaagtttttgttctggaagtgatgggccgccacgcaggatggattgccgcagcg
ggcggattggcttcgagtccagattgtgaaattccaataatcattttgtttccagaaatt
acattcaacaaagaaaagtttcttgccaaagtggatcgctatgtcaaggaatatggctat
tgctcagtcgtcgtatctgaaggtgttaagggggaagatggtaattttctttccgaccag
ggactgcgtgatgcctttgggcatgcacaactaggcggcgttgcaccggtggtagccaat
atcatcaaagatggtttgggattgaaatatcattggggtgttgctgattatctacagcgt
gctgcacggcacattgcttccaagaccgatgtggaacaagcttatgcaatgggtaaagcg
gcagtggaatatgctattgcaggacataactcagtcatgccaacgatagttcgtcaatcc
aatgcaccttatagctggacggtgggcatggctaagcttgctaatgtagccaatgtcgag
aaaatgatgccggctgattatatcagtgaagacggatttggcattagtcaggcttgccgc
aaatacttatcgccactgattgagggtgaagattatccaccttataaaaatggattgcca
gattatgtgcggttaaaaaatgtagcggttgagaagaaattgggcgagttcaaaatttaa

DBGET integrated database retrieval system