KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0235Help
Entry
Nit79A3_0235      CDS       T01569                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nit79A3_0235
   01230 Biosynthesis of amino acids
    Nit79A3_0235
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_0235
   00030 Pentose phosphate pathway
    Nit79A3_0235
   00051 Fructose and mannose metabolism
    Nit79A3_0235
   00052 Galactose metabolism
    Nit79A3_0235
  Energy metabolism
   00680 Methane metabolism
    Nit79A3_0235
Enzymes [BR:nii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Nit79A3_0235
Protein phosphatases and associated proteins [BR:nii01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Nit79A3_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(273944..275203)
Genome map
AA seq 419 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASAAGVLETARQHSDKIGNVYAGRNGIIGALTEDLIDTNAD
SAAAIAALRHTPSGAFGSCRYKLKSLEQNRREYERLIEVFKAHNIGYFFYNGGGDSADTC
LKVSQLSDTLGYPLQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTREASFDVASMSKT
STKVFVLEVMGRHAGWIAAAGGLASSPDCEIPIIILFPEITFNKEKFLAKVDRYVKEYGY
CSVVVSEGVKGEDGNFLSDQGLRDAFGHAQLGGVAPVVANIIKDGLGLKYHWGVADYLQR
AARHIASKTDVEQAYAMGKAAVEYAIAGHNSVMPTIVRQSNAPYSWTVGMAKLANVANVE
KMMPADYISEDGFGISQACRKYLSPLIEGEDYPPYKNGLPDYVRLKNVAVEKKLGEFKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaaaatgcattttatgcccaatccggcggcgtaacggctgtaatcaacgct
tcggccgcgggtgttctagaaacagcgcgccagcactctgataaaattggcaatgtctat
gcaggtcgcaatgggattatcggtgcgttgaccgaagatttgattgataccaatgctgat
tcagcagcagcgattgctgcgctacgtcataccccgtcaggtgcatttggatcgtgccgc
tacaaattaaagagcttggagcaaaatcgacgcgaatacgaacgtctgatcgaagtattc
aaagcgcataatattggttatttcttttataatggcggcggtgattctgcggatacctgc
cttaaggtttcacaattatccgatacgctcggctatccccttcaggcgattcacgttccc
aaaacggttgacaacgatttgccaatcacagattgttgccctggttttggctctgtcgcc
aaatatatcgcggtatccacacgcgaagcgagctttgatgtagccagcatgtctaaaaca
tcaactaaagtttttgttctggaagtgatgggccgccacgcaggatggattgccgcagcg
ggcggattggcttcgagtccagattgtgaaattccaataatcattttgtttccagaaatt
acattcaacaaagaaaagtttcttgccaaagtggatcgctatgtcaaggaatatggctat
tgctcagtcgtcgtatctgaaggtgttaagggggaagatggtaattttctttccgaccag
ggactgcgtgatgcctttgggcatgcacaactaggcggcgttgcaccggtggtagccaat
atcatcaaagatggtttgggattgaaatatcattggggtgttgctgattatctacagcgt
gctgcacggcacattgcttccaagaccgatgtggaacaagcttatgcaatgggtaaagcg
gcagtggaatatgctattgcaggacataactcagtcatgccaacgatagttcgtcaatcc
aatgcaccttatagctggacggtgggcatggctaagcttgctaatgtagccaatgtcgag
aaaatgatgccggctgattatatcagtgaagacggatttggcattagtcaggcttgccgc
aaatacttatcgccactgattgagggtgaagattatccaccttataaaaatggattgcca
gattatgtgcggttaaaaaatgtagcggttgagaagaaattgggcgagttcaaaatttaa

DBGET integrated database retrieval system