KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0299Help
Entry
Nit79A3_0299      CDS       T01569                                 

Definition
(GenBank) hypothetical protein
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00010  Glycolysis / Gluconeogenesis
nii00710  Carbon fixation in photosynthetic organisms
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01120  Microbial metabolism in diverse environments
nii01130  Biosynthesis of antibiotics
nii01200  Carbon metabolism
nii01230  Biosynthesis of amino acids
Module
nii_M00002  Glycolysis, core module involving three-carbon compounds
nii_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_0299
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nit79A3_0299
Enzymes [BR:nii01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Nit79A3_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_N Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEJ00196
UniProt: F8GH30
Position
327900..328955
Genome map
AA seq 351 aa AA seqDB search
MHTGEPIRICIRGMSGMLGNRLAICLDKQKDMTLTAGIVRNGVHLDKILNGFASTNRLPE
HIYLDAGKDVVKSLNKSQSRVKFEHIEQLNLSDVCDIVIDTTPSGNGKAWRDRYAAFGKY
VVFQSGAFPDGSLITPPYLIKDKREKFFRQGNCIISALSPIFYALDEMIESAKINVIMQY
TGKLLVDIPTNQRIHSTYLADELFLQMNEELGSLFPYKNIRLSDLYQVPSLDYYSMSLHL
VLKEKVTKKNIRKILMDTPRIFVTPDVITSTYEIDHFLREQVKESGNDLPPITVYGCDLA
DDIRRNEIVIRAAIYSRTIAVLPNIDAIRMLVKDEDPIEAMRRTDTYAGFS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcatactggagaaccaatacgtatatgtatacgtggaatgtcaggaatgctaggaaac
aggctggcaatttgtctagataaacagaaagatatgacgcttaccgccgggatagtcagg
aatggtgtacatctagataaaatattaaatggttttgcatctaccaatagattacctgaa
cacatatatcttgatgctgggaaagacgttgtaaagtcacttaacaaatcgcaatcaaga
gtgaaatttgaacatatcgagcaacttaatctgtccgatgtttgcgatatagttatagat
acaacgccatctggaaatggaaaggcatggcgagatagatatgcagcttttggcaaatat
gtagtctttcagtcaggagcattcccagatggatcactaattacgccaccttatcttatt
aaagataagagagaaaagttttttcgtcaagggaactgcataatctcagcattatcaccc
atattttatgcattagatgaaatgatagagagtgcaaaaataaacgtgataatgcaatat
acgggaaaattattagtggacataccgacaaaccaaagaattcattcaacatatttagct
gacgaactatttttacagatgaatgaggagctgggatctctgtttccttataaaaacata
agattatctgatctttaccaagttccaagtctagactattatagtatgtcattacatctg
gtactaaaggagaaagtgactaaaaaaaatattagaaaaatacttatggacaccccccga
atatttgtgacaccagatgtaataacatctacatatgaaattgatcatttcttaagagaa
caagtaaaggaatccggaaatgatttgccaccaattacggtatatggttgtgatcttgct
gatgatataagaagaaacgagattgtaatcagagcagcgatatattcaaggacaatagcc
gtacttccgaacattgatgcgatcagaatgctagtaaaagatgaagatccaattgaagca
atgagaaggactgacacatatgctggattttcttga

DBGET integrated database retrieval system