KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0299Help
Entry
Nit79A3_0299      CDS       T01569                                 

Definition
hypothetical protein
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nit79A3_0299
   01230 Biosynthesis of amino acids
    Nit79A3_0299
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_0299
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nit79A3_0299
Enzymes [BR:nii01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Nit79A3_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327900..328955
Genome map
AA seq 351 aa AA seqDB search
MHTGEPIRICIRGMSGMLGNRLAICLDKQKDMTLTAGIVRNGVHLDKILNGFASTNRLPE
HIYLDAGKDVVKSLNKSQSRVKFEHIEQLNLSDVCDIVIDTTPSGNGKAWRDRYAAFGKY
VVFQSGAFPDGSLITPPYLIKDKREKFFRQGNCIISALSPIFYALDEMIESAKINVIMQY
TGKLLVDIPTNQRIHSTYLADELFLQMNEELGSLFPYKNIRLSDLYQVPSLDYYSMSLHL
VLKEKVTKKNIRKILMDTPRIFVTPDVITSTYEIDHFLREQVKESGNDLPPITVYGCDLA
DDIRRNEIVIRAAIYSRTIAVLPNIDAIRMLVKDEDPIEAMRRTDTYAGFS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcatactggagaaccaatacgtatatgtatacgtggaatgtcaggaatgctaggaaac
aggctggcaatttgtctagataaacagaaagatatgacgcttaccgccgggatagtcagg
aatggtgtacatctagataaaatattaaatggttttgcatctaccaatagattacctgaa
cacatatatcttgatgctgggaaagacgttgtaaagtcacttaacaaatcgcaatcaaga
gtgaaatttgaacatatcgagcaacttaatctgtccgatgtttgcgatatagttatagat
acaacgccatctggaaatggaaaggcatggcgagatagatatgcagcttttggcaaatat
gtagtctttcagtcaggagcattcccagatggatcactaattacgccaccttatcttatt
aaagataagagagaaaagttttttcgtcaagggaactgcataatctcagcattatcaccc
atattttatgcattagatgaaatgatagagagtgcaaaaataaacgtgataatgcaatat
acgggaaaattattagtggacataccgacaaaccaaagaattcattcaacatatttagct
gacgaactatttttacagatgaatgaggagctgggatctctgtttccttataaaaacata
agattatctgatctttaccaagttccaagtctagactattatagtatgtcattacatctg
gtactaaaggagaaagtgactaaaaaaaatattagaaaaatacttatggacaccccccga
atatttgtgacaccagatgtaataacatctacatatgaaattgatcatttcttaagagaa
caagtaaaggaatccggaaatgatttgccaccaattacggtatatggttgtgatcttgct
gatgatataagaagaaacgagattgtaatcagagcagcgatatattcaaggacaatagcc
gtacttccgaacattgatgcgatcagaatgctagtaaaagatgaagatccaattgaagca
atgagaaggactgacacatatgctggattttcttga

DBGET integrated database retrieval system