KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0365Help
Entry
Nit79A3_0365      CDS       T01569                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nit79A3_0365
   00630 Glyoxylate and dicarboxylate metabolism
    Nit79A3_0365
   00640 Propanoate metabolism
    Nit79A3_0365
   00650 Butanoate metabolism
    Nit79A3_0365
  Lipid metabolism
   00071 Fatty acid degradation
    Nit79A3_0365
   00072 Synthesis and degradation of ketone bodies
    Nit79A3_0365
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nit79A3_0365
   00310 Lysine degradation
    Nit79A3_0365
   00380 Tryptophan metabolism
    Nit79A3_0365
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nit79A3_0365
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Nit79A3_0365
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nit79A3_0365
Enzymes [BR:nii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Nit79A3_0365
Exosome [BR:nii04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nit79A3_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
393830..395008
Genome map
AA seq 392 aa AA seqDB search
MRDVVILSGVRTAIGDYGGALKNAAPADLASKVVQEAVLRAGIDPDAVGHLVFGNVIHGE
SRDMYLARVACINGGLAQHTSALTVNRLCGSGLQAIISASQNILLNDTDVAVAGGAESMS
RGGYLLPALRWGQRMNDGGTVDMMIGALTDPFDNVHMGITAENIAAKWQISREVQDTFAA
ESHRRALHAIRNGYFKEQILPIEITTHKEKIRFDTDEHPRENTSMETLSKLRPVFQEDGT
VTAGNASGINDSAAAVVLMESKAAQRCDLKPLARLVSYGHAGVDPKFMGIGPVPAVQKAL
RRANLKIADIDVIESNEAFAVQACAVAKELQFDPEKTNPNGGAVALGHPIGATGSILTIK
AIYELHRCGGRYALVTMCIGGGQGIAAILERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagggatgttgtcattctgagtggcgtgcgcacggccatcggtgattacggcggcgca
cttaaaaatgctgctcctgcagatttggcgtcaaaggtcgtgcaggaagcagtattacgc
gccggaattgatccagatgctgttgggcacctggtttttggcaatgtaatacacggagaa
tctcgcgatatgtatttagcgcgcgttgcttgtattaatggcggcttagcgcaacacact
tcagcgctgacagtgaaccggctgtgtgggagcggtctacaagccatcatctcggcaagt
caaaatattctgctaaatgacaccgatgtggcagttgccggtggcgctgaatccatgagt
cgaggaggatatttgttacctgccttgcggtgggggcaacgcatgaatgatggtggtacc
gtagatatgatgatcggggcattgaccgatccattcgataacgtgcatatgggcattact
gccgagaatattgccgctaaatggcaaatcagccgtgaagtacaagatacatttgcggca
gaaagtcatcggcgtgccctacatgcgataaggaatggttattttaaagagcaaatattg
cctattgaaataacgacacataaagaaaaaatccgttttgatacggacgagcatccccgt
gaaaacacaagtatggagactctgtcaaagcttcgtcctgtttttcaagaagatggcacg
gtaacggcaggcaatgcctccggtattaatgatagtgccgccgcagtggtgctcatggaa
agtaaagcagcgcagagatgcgacttgaaaccgttggcgcgactggtttcttatggtcat
gccggtgttgatccaaaatttatgggcatcgggccggtgccggctgttcagaaagctttg
cggcgtgcaaatcttaaaatagcagatattgatgtcattgaatccaacgaggcctttgct
gtgcaagcttgtgctgtagcaaaagaactgcaatttgatccagaaaaaaccaatccgaat
ggtggtgctgtcgcattgggtcatcccatcggtgcaactggcagtatcttgacgattaag
gctatttatgaattgcaccgatgcggcgggagatatgcattggtgaccatgtgcatcggt
ggcggccaggggattgctgcaatattagaaaggctatag

DBGET integrated database retrieval system