KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0379Help
Entry
Nit79A3_0379      CDS       T01569                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nii00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nit79A3_0379
Enzymes [BR:nii01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Nit79A3_0379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406978..407562
Genome map
AA seq 194 aa AA seqDB search
MIGRLTGILLEKHPPQVLLDVQGVGYEIDVPMSTFYDLPMTGMQTTLYTHLVIREDVHLL
FGFATESERQTFRQLIKISGVGARTALALLSGLSVPDLYRAVGDQDSTRLIRVPGIGKKT
AERLLLELRDKLDTEGINLDQSSATPNNGSDILNALLSLGYNDREADWAIKQIASNANVS
DGIRQALQLLSKEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcgattaacaggtatcttgctcgaaaaacatcctccgcaggtgttgttggat
gtacagggggttggttatgaaatagatgtgccgatgagtactttttatgatcttccaatg
accggtatgcagacgacattgtatacgcatcttgtgatacgtgaagatgtgcatctcttg
tttggtttcgcaacggaatcggagcgtcagacttttcgccagctgataaagatttcaggg
gtaggcgcaagaactgcgttggcacttttatcaggtttgagtgtgcctgatctgtaccga
gctgtgggagaccaagatagtacacgactcattcgagtgcccggtatcgggaaaaagaca
gctgagcgcttgttgctggagttgcgggataagctggatactgagggtatcaatttagac
caaagctcagctactcctaataatggtagtgacatactcaatgccttgttatcattaggt
tataatgatcgggaagccgattgggccattaagcaaatcgcatcaaatgcaaacgtttcc
gatggaatacggcaggcgttgcaactattatctaaggaaaagtag

DBGET integrated database retrieval system