KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0522Help
Entry
Nit79A3_0522      CDS       T01569                                 

Definition
phosphoribosylglycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nii00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:nii00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(564682..565320)
Genome map
AA seq 212 aa AA seqDB search
MKSLVILISGRGSNMQALLEAGFQADRITVISNNPNATGLEIARKYGAKTIVIDHRTFPD
RQTFDTALAEKIDACQPKLIALAGFMRILSDRFVQRYQGRLMNIHPSLLPAFPGLGTHAR
ALQEGIKIHGCTVHFVTAQLDHGPVVIQAAIPVLPEDTEETLAARVLQQEHRIYPQAVRW
FMEDQIRFTENHVEVIDSSVREIALYSPGLPE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactggtcattctaatctccggccgcggcagtaatatgcaggcgctattggaa
gcgggatttcaggcagatcgcatcacggtaatcagtaacaatccgaatgcaacagggttg
gaaatcgcccggaaatatggtgccaaaaccatcgtcatcgatcatcgtacttttccagat
aggcaaacatttgatacggcattggcagaaaaaattgacgcttgccaacccaaactgatt
gcactggctggcttcatgcgtatactaagcgatcgctttgtgcaacgttatcaaggccga
ttaatgaatattcatccttcattattacccgcatttccaggtttgggaacgcatgcaaga
gcactgcaagaagggatcaaaatacatggctgtaccgtacattttgtcactgcacagctg
gatcatgggccggttgtgattcaggctgctattcctgtattgcccgaagatactgaggaa
acactggcagcccgggttttacagcaggaacatcgtatttaccctcaggccgtacgctgg
tttatggaagatcaaatccgatttactgagaatcacgttgaagtgatagactccagtgtt
cgtgaaatagcgctttattcaccaggactacccgaatga

DBGET integrated database retrieval system