KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0571Help
Entry
Nit79A3_0571      CDS       T01569                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nii00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nii00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
606535..607494
Genome map
AA seq 319 aa AA seqDB search
MINRNPQLDENGVLQHLLTTEGLPASILLHILDTAESFVGVTERDVKKIPLLRGKSIFNL
FFEPSTRTRTTFEIAAKRLSADVINLNIAVSAQSKGETLLDTVNNLTAMNADMFIVRHAQ
SGAAHLIAKHVRSDVHVINAGDGSHAHPTQALLDMFTIRRYKRDFHNLRVAIVGDILHSR
VARSQIHALTTLGVPEVRVIAPKTLLPRMVERLGVHVYHDMAKGLKDVDVVMMLRLQNER
MKGANLPSSEEFFKYYGLTPDKLSLARRDAIVMHPGPMNRGVEIDSAVADGKQSVILSQV
TFGIAVRMAVMSILAGNQV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatcaataggaatccgcaactcgatgaaaatggtgtgctgcagcatttactgacaacg
gaaggattgccggcttctattttgctgcatatattggatactgccgaatcattcgtgggt
gtcaccgaacgtgatgtcaaaaagatcccattgctgcgtggaaaatcgatattcaatctt
ttttttgaacccagtacacgcacacgaacgacatttgaaattgctgccaagcgtttgtcg
gcagacgtcatcaatctcaatattgcagtttctgcgcaatccaagggtgagacattactg
gatacagtcaataatctcaccgcgatgaatgcggacatgtttattgtgcggcatgcacag
agcggtgctgctcatttgattgccaagcatgtccggtcagatgttcatgtgattaatgct
ggtgatgggagtcatgcacatccgacacaagctttgctggatatgttcacaatccggcgc
tacaaacgggattttcataacttgcgcgtagctattgttggcgatattctgcattccaga
gtagcacgctcccagattcatgcattgactacactgggcgtgccggaagttcgcgtgatt
gcacctaagactttgttaccaagaatggtggagcggctgggtgtgcatgtttatcacgat
atggcgaaggggctcaaagatgttgatgtagtgatgatgttgcgtttgcaaaatgaacgg
atgaaaggcgcgaacttacccagctcggaggaattttttaaatactatggacttactccg
gataaattatccctcgcccggcgtgacgcgatcgttatgcaccctggtccgatgaatcgc
ggtgtggaaatcgattctgcggttgccgatggcaaacagtctgtaattttgtctcaagtc
acattcggtatagcggtgcgtatggctgtgatgtcaattctggcaggcaatcaggtctaa

DBGET integrated database retrieval system