KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0643Help
Entry
Nit79A3_0643      CDS       T01569                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00010  Glycolysis / Gluconeogenesis
nii00260  Glycine, serine and threonine metabolism
nii00680  Methane metabolism
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01120  Microbial metabolism in diverse environments
nii01130  Biosynthesis of antibiotics
nii01200  Carbon metabolism
nii01230  Biosynthesis of amino acids
Module
nii_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_0643
  Energy metabolism
   00680 Methane metabolism
    Nit79A3_0643
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nit79A3_0643
Enzymes [BR:nii01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Nit79A3_0643
Membrane trafficking [BR:nii04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Nit79A3_0643
Exosome [BR:nii04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Nit79A3_0643
  Exosomal proteins of melanoma cells
   Nit79A3_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEJ00522
UniProt: F8GJP3
Position
complement(696722..697471)
Genome map
AA seq 249 aa AA seqDB search
MKKIVLLRHGESTWNKENRFTGWTDVDLTPKGLQEAQNAGQLLHEQGFAFDVAYTSVLKR
AIRTLWVVLDEMNQMWIPIQHTWRLNERHYGALQGLNKAETAAEYGDEQVLIWRRSYDVR
PPALTTDDERYAGTDPRYKDLASEDIPLTECLKDTVARFLPYWNAVIAPQVQSGKSVIIA
AHGNSLRALVKYLDNISDEEILNCNIPTGIPLVYELDDNMKPIRSYYLGNQNKIQEAMQI
VANQGKSAV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgttctcctgcgtcatggagaaagtacctggaataaagaaaatagattt
actggctggacagatgttgatttaacacctaaaggcttgcaggaagcgcaaaatgccggg
cagcttctacacgagcaagggtttgcatttgatgtcgcgtatacgtcagttctcaaacgc
gccattcgcaccttatgggtagtgcttgatgaaatgaaccaaatgtggattcccatacaa
cacacttggcgattaaatgaacgtcattatggcgctctacaaggtttgaacaaagccgaa
actgcagccgaatatggcgatgagcaagttttaatatggcgaagaagctatgatgtcagg
ccgcccgcattaaccaccgatgatgaacgctatgctggcactgatccgcgatataaagac
ttagcgtctgaggatatacctttgaccgagtgcctaaaagatacggtcgcaagattttta
ccctattggaatgcggttatagcacctcaagttcagtctggaaaaagcgttatcattgct
gcacatggaaattctttaagagcactggttaagtatttggataatatctctgatgaagag
atcttaaactgcaacattccaaccggcatcccgttagtttatgaattagatgataatatg
aagccgatcaggagttattatttagggaatcagaacaaaattcaggaagccatgcaaatt
gtagctaatcagggtaagtcagcagtttag

DBGET integrated database retrieval system