KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0678Help
Entry
Nit79A3_0678      CDS       T01569                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Nit79A3_0678
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nit79A3_0678
Enzymes [BR:nii01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Nit79A3_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
739530..740078
Genome map
AA seq 182 aa AA seqDB search
MKSTQLAIPEVLLFEPRVFGDERGFFFESFNQREFESAVGEKINFVQSNHSRSIQHVLRG
LHYQIKQAQGKLVRVVVGEVFDVAVDIRRSSPTFGQWVGEILSAENKKQLWVPAGFAHGF
IVLSDYAEFLYNTTDYWAPEYERCIVWNDATLAIDWPLAGKQPILSEKDARGISFNAAEV
YD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaacccagttggctattccagaagttctgttatttgaaccgcgtgtttttggc
gatgaacgcgggttctttttcgaaagttttaatcagcgtgaatttgagtcagcagtaggg
gaaaaaataaactttgtacaaagtaatcactcacgttccattcaacatgttttgcgcggc
ttgcattaccagatcaaacaagcccaaggaaagctggtgcgtgtggtggtgggagaagta
ttcgacgtggcagtggatatccgccgttcatccccaacttttggacaatgggtgggagaa
atactcagcgcagagaacaaaaaacaattatgggttccggcaggctttgcccatgggttt
atagtcctctctgattatgcggagtttttatataacacgactgattactgggcgcctgaa
tacgagcgctgcattgtgtggaatgatgcaactttggcgatagattggccgcttgctggc
aagcagccaattctgtctgaaaaggatgcgcgtggaatctcattcaatgctgccgaagtt
tatgattag

DBGET integrated database retrieval system