KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0836Help
Entry
Nit79A3_0836      CDS       T01569                                 

Definition
Protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nii  Nitrosomonas sp. Is79A3
Brite
Enzymes [BR:nii01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nit79A3_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918845..919480
Genome map
AA seq 211 aa AA seqDB search
MTSQRTRMRMIERLRAQGISDEVILSVIGTIPRHIFVEEALASRAYEDVSLPINYGQTIS
SPWIVARMSELLRANSTLGKVLEIGTGCGYQTAVLAQIAQKVYSIERIGPLLTRTRIRLQ
ELQIRNVYLKHADGLLGLAEAGPFDGIIMTAVTTHVPASLLEQMVVGGRMVFPKGTQKQN
LCIIERNSQGYTETVLEEVNFVPLLAGVVKK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcagcgcacacgtatgcgaatgattgaacgcttacgtgcacaaggaatttct
gatgaagtgattttatcagttataggtacaattccgcgtcatatttttgttgaagaagct
ctggcaagccgggcttatgaagatgtttctttacccataaattacggacagactatatcc
agcccatggattgttgcgcgtatgagtgagctattacgtgcaaattctacattaggtaaa
gtactggaaattggaactgggtgtggctatcagactgctgtactggcacagattgcgcag
aaagtttattcgatagaacgtattgggccattattaacacgtaccagaattcgtctgcaa
gaattacagatcaggaatgtttatttaaaacatgcagatggtttgttagggcttgcggaa
gcagggccgtttgatggtattatcatgacagcagtgacaacacatgttcctgcttcatta
ttggagcaaatggtggtaggtggcagaatggtttttcccaaaggaactcagaaacagaac
ttgtgtattattgaacggaattcccaaggttatactgaaactgtactggaagaggtgaat
tttgtacctttactagcaggggttgtaaaaaaatag

DBGET integrated database retrieval system