KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0841Help
Entry
Nit79A3_0841      CDS       T01569                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nit79A3_0841
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nit79A3_0841
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nit79A3_0841
Enzymes [BR:nii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nit79A3_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
924264..925682
Genome map
AA seq 472 aa AA seqDB search
MRYISTRGGMPPKSFSEILLSGLSPDGGLAIPEAYPQITAAELNAWRGLSYPALAFEILS
RFVDDIPSNDLRNLIHQTYTAEVFGSADVAPLKTLEPGLHILGLSNGPTLAFKDIAMQLL
GNLFQYQLAKTGDELNILGATSGDTGSSAEYAMRGKHGIRVFMLSPLGKMSRFQTAQMFS
LQDKNIFNIAIRGVFDDCQDIVKAVSNDHAYKQAHRIGTVNSINWARIVAQVVYYFKGYF
AATKSNDEQVSFAVPSGNFGNICAGHVARMMGLPIKRLILATNENDVLDEFFRTGVYRPR
TTTETQHTSSPSMDISKASNFERFIFDLTGRNAKQVAELWSAVDKGNAFDLSTTPLFAKI
KDYGFMSGSSNHAARIATIRDIYQRYQVLVDTHTADGLKVGQAHREAGVPLICLETALPA
KFAESIQEAIGREPERPAGFENLESLPQRFVVKDADVQVVKNYIDEQCSIFM
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatatctcgacccgtggtggaatgccacctaaatctttttcagaaatcctacta
agcggattgtctcccgatggcggattggcgataccggaagcgtatccgcaaattaccgca
gcagaattgaatgcgtggcgtggcctgagttatccggcgcttgcgttcgaaatcctgtcg
cgctttgtcgatgatattccgtcgaacgatttgcgcaatctgattcatcaaacctatacc
gccgaagtgtttggcagtgcagatgtcgcgccgcttaaaacactggaaccgggtttgcat
atcctgggattgtccaatgggccgacgttggcgttcaaggacatcgcgatgcagttgctt
ggcaatttgtttcaataccaactggccaaaaccggtgacgagctgaacattctcggtgcg
acctcgggtgataccggttccagcgccgaatacgccatgcgcggcaagcacggcatccgg
gtttttatgttgtctccgctagggaaaatgagccgtttccagacggcgcagatgttttcc
ttgcaggataaaaacattttcaatattgccatccgcggcgtatttgacgattgtcaggat
attgtcaaggcagtcagcaacgatcatgcttacaaacaagcgcatcgaataggcacggtc
aattcaatcaactgggcgcgcattgtggcgcaggtggtgtattacttcaaaggttatttt
gctgcaaccaaatccaacgatgaacaagtgtcttttgctgtgccatccggcaattttggc
aatatttgcgcgggtcacgtggcgcgaatgatgggcctgccgattaaacgcctaattctg
gcgaccaatgaaaatgacgtattggatgaattcttcagaaccggggtgtaccgtccgcgc
acgacgacggaaacccaacacaccagcagcccgtcaatggatatttccaaagcctccaat
tttgagcgcttcatttttgatttgaccggaagaaacgccaagcaagtggctgaattgtgg
tcggcggtggacaaaggcaatgcttttgatttatcgactaccccgctgttcgcaaaaatc
aaggattacggcttcatgtccggcagcagcaaccacgccgcgcggattgccacgattcgc
gacatctatcagcgctatcaggtgctggtcgatacacataccgcggatggcctgaaagtc
ggtcaagcgcaccgggaagccggagtgccgctgatttgcctggaaaccgcattgcccgcg
aaatttgccgaaagcatccaggaagccattggccgcgaaccggaacgcccggcgggtttt
gagaacttggaaagtttgccgcagcggtttgtggttaaggatgcggatgtgcaggtggtg
aagaattatattgatgagcagtgtagtatattcatgtag

DBGET integrated database retrieval system