KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0841Help
Entry
Nit79A3_0841      CDS       T01569                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00260  Glycine, serine and threonine metabolism
nii00750  Vitamin B6 metabolism
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01120  Microbial metabolism in diverse environments
nii01230  Biosynthesis of amino acids
Module
nii_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nit79A3_0841
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nit79A3_0841
Enzymes [BR:nii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nit79A3_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEJ00716
UniProt: F8GLH0
Position
924264..925682
Genome map
AA seq 472 aa AA seqDB search
MRYISTRGGMPPKSFSEILLSGLSPDGGLAIPEAYPQITAAELNAWRGLSYPALAFEILS
RFVDDIPSNDLRNLIHQTYTAEVFGSADVAPLKTLEPGLHILGLSNGPTLAFKDIAMQLL
GNLFQYQLAKTGDELNILGATSGDTGSSAEYAMRGKHGIRVFMLSPLGKMSRFQTAQMFS
LQDKNIFNIAIRGVFDDCQDIVKAVSNDHAYKQAHRIGTVNSINWARIVAQVVYYFKGYF
AATKSNDEQVSFAVPSGNFGNICAGHVARMMGLPIKRLILATNENDVLDEFFRTGVYRPR
TTTETQHTSSPSMDISKASNFERFIFDLTGRNAKQVAELWSAVDKGNAFDLSTTPLFAKI
KDYGFMSGSSNHAARIATIRDIYQRYQVLVDTHTADGLKVGQAHREAGVPLICLETALPA
KFAESIQEAIGREPERPAGFENLESLPQRFVVKDADVQVVKNYIDEQCSIFM
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatatctcgacccgtggtggaatgccacctaaatctttttcagaaatcctacta
agcggattgtctcccgatggcggattggcgataccggaagcgtatccgcaaattaccgca
gcagaattgaatgcgtggcgtggcctgagttatccggcgcttgcgttcgaaatcctgtcg
cgctttgtcgatgatattccgtcgaacgatttgcgcaatctgattcatcaaacctatacc
gccgaagtgtttggcagtgcagatgtcgcgccgcttaaaacactggaaccgggtttgcat
atcctgggattgtccaatgggccgacgttggcgttcaaggacatcgcgatgcagttgctt
ggcaatttgtttcaataccaactggccaaaaccggtgacgagctgaacattctcggtgcg
acctcgggtgataccggttccagcgccgaatacgccatgcgcggcaagcacggcatccgg
gtttttatgttgtctccgctagggaaaatgagccgtttccagacggcgcagatgttttcc
ttgcaggataaaaacattttcaatattgccatccgcggcgtatttgacgattgtcaggat
attgtcaaggcagtcagcaacgatcatgcttacaaacaagcgcatcgaataggcacggtc
aattcaatcaactgggcgcgcattgtggcgcaggtggtgtattacttcaaaggttatttt
gctgcaaccaaatccaacgatgaacaagtgtcttttgctgtgccatccggcaattttggc
aatatttgcgcgggtcacgtggcgcgaatgatgggcctgccgattaaacgcctaattctg
gcgaccaatgaaaatgacgtattggatgaattcttcagaaccggggtgtaccgtccgcgc
acgacgacggaaacccaacacaccagcagcccgtcaatggatatttccaaagcctccaat
tttgagcgcttcatttttgatttgaccggaagaaacgccaagcaagtggctgaattgtgg
tcggcggtggacaaaggcaatgcttttgatttatcgactaccccgctgttcgcaaaaatc
aaggattacggcttcatgtccggcagcagcaaccacgccgcgcggattgccacgattcgc
gacatctatcagcgctatcaggtgctggtcgatacacataccgcggatggcctgaaagtc
ggtcaagcgcaccgggaagccggagtgccgctgatttgcctggaaaccgcattgcccgcg
aaatttgccgaaagcatccaggaagccattggccgcgaaccggaacgcccggcgggtttt
gagaacttggaaagtttgccgcagcggtttgtggttaaggatgcggatgtgcaggtggtg
aagaattatattgatgagcagtgtagtatattcatgtag

DBGET integrated database retrieval system