KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0849Help
Entry
Nit79A3_0849      CDS       T01569                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nit79A3_0849
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nit79A3_0849
  Amino acid metabolism
   00310 Lysine degradation
    Nit79A3_0849
Enzymes [BR:nii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Nit79A3_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
934762..936021
Genome map
AA seq 419 aa AA seqDB search
MLVEVKVPMLSESVAEATLISWHKKAGDYVNRSENLIDVETDKVVLELPAPSAGVLTKIL
KKDGATVASGEVIAMIETEATDQQDNQPKLAPATEKQTEIPAVKTTETISAKGDEQMAPL
LMPAAHKLAEENNLRAAEISAIKGTGLGGRVTKEDVQAYMESKPSPAADAETKSGSVSTP
APPVPGARAERRVAMSRLRQRVAERLVQSQSTAAILTTFNEVNMQAIIDLRTRYKAEFEK
EYGVKLGFMSFFVKAVIAALKKYPIINASVEGNDIVYHDYYDIGIAVGSPRGLVVPVIRD
ADRLTLAGIELQIAEFAKRAQDGKLTIEELSGGTFSITNGGVFGSMLSTPIINPPQSAIL
GIHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKEALEYPMSPLLEA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgctagttgaagtcaaagttcccatgttatctgaatccgtagcggaagctaccttaata
tcctggcataaaaaagcaggagattacgtcaaccggtcagaaaacctgattgatgtcgaa
accgacaaggtagtgcttgaattgcctgcgcccagtgctggtgtattgaccaaaatttta
aaaaaagatggcgcaacggttgccagcggtgaagtcatcgcgatgattgagacggaagca
accgatcaacaggataatcaacctaaactggcacccgctaccgaaaagcagactgaaata
ccggctgttaaaactactgaaacgatcagcgccaaaggcgatgaacaaatggcaccgctg
ttgatgcctgctgcacacaaactggcggaagaaaataacttgagagcggcggaaatcagt
gccatcaaagggactggcttgggcgggcgtgttactaaagaagatgtgcaagcgtatatg
gaaagcaaacccagcccggcagcagatgccgagactaaatccggttcagtcagtacacca
gcgccacctgttccgggtgcgcgtgcggaacgccgagtggccatgtccagactgcggcag
cgggttgcggaacgtctggtgcaatcgcaatccaccgcggcgattctgactacgtttaat
gaagtcaatatgcaggcgattattgatctgcgcacacgctataaagccgagtttgagaag
gagtatggtgtcaagcttggctttatgtcgttcttcgtcaaagcagtcattgctgcatta
aagaaatatccgattattaatgcatccgttgaaggcaatgacattgtttatcacgattac
tacgacatcggcatcgccgtcggcagtccgcgcggactggtggttccggttatccgtgat
gcagaccgtttaacgctggccgggattgaactgcagatcgccgaattcgccaaacgcgcg
caggacggcaagctaaccattgaagaactcagcggcggtactttctcgattaccaacggt
ggtgtattcggctccatgttgtccacgccgattattaatccgccgcaaagcgctattttg
ggtatccatgcgaccaaggaacgcgcagtggtcgagaacggacaaatcgtgatccgtccg
atgaattatctggctttgtcgtacgatcaccggattatcgatggccgggaagcggtattg
tctctggtggcgatgaaagaagcgttggaatatccgatgagtccgttgttggaggcatga

DBGET integrated database retrieval system