KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0919Help
Entry
Nit79A3_0919      CDS       T01569                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
nii  Nitrosomonas sp. Is79A3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1007244..1008956
Genome map
AA seq 570 aa AA seqDB search
MKPLKDSNPTIIARETLRQLASLRIPPTPDNYHKLYDQISGNSGDDVNSAAVTSTNQQRI
VDNPTIESAVTWGDTIEALLKQLEKKQGALTTAKKRDGVNRVLAKYSKDSNQLHNKLKAL
VDSWGALAAATQDSNEDGQVQNPSLQVPQVDQDTQGSQLKHAVTEQTPTAGYFADQLLEL
LAHLLEQVVAKQIGDVILVEEARTLAHQVRKIQDKPEMEQFIAGFQQFCGKFDAYGESGL
KLQQGLLKLLNMLMDSTGELLSEDQWIGVQISKLRETISRPLDHQVIAQAEHYLEEITQR
QEIIGRSLSEAKVTLKQMVTSLITNIEELTDTTGEYQNKLEQYSEKISNTDDIKELNQLL
VLIMEETSLMQKSTLNYRNDFLAARAEVSLAQNKINQLETELHEMGEKVHEDHLTGILNR
RGLDNAFDRETSRSMRHQVPLCFALLDIDNFKLLNDTHGHQVGDDALVYLVESVKETTRP
EDIVSRYGGEEFVILLPNTNLEEAVHILSRIRRNLTKKFFLHENKRLLITFSAGVAQLQP
GESQESIFKRADEALYRAKRGGKNQILTSV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcttaaagattcgaatccaaccattattgcccgtgaaacattgcggcagctt
gcatcgctcagaattcctccaacaccagataattatcacaaactgtatgaccagatttca
ggtaattccggagatgatgtgaattccgcggcggtaacatcaacaaatcagcaaagaatt
gttgataatccaacaatagaatccgctgtgacctggggagatacgatagaagcactgttg
aagcaactggaaaagaagcaaggagcgctgaccactgcaaagaaacgggatggcgtcaat
cgagttcttgccaaatactcgaaagattcaaaccaactgcataacaaactcaaggcgctg
gtagattcatggggagcattggctgccgcaacccaagactcaaatgaagatgggcaagtg
caaaatccctcattgcaagtgccgcaggttgatcaggacacacaaggctcccaattaaag
catgctgttacagaacagactccgaccgccggatattttgctgatcagctattggaattg
ctggcacacttgcttgaacaggttgttgctaaacagattggtgacgtaattttggttgaa
gaagccagaacgttagcgcatcaagtgcgcaaaattcaagataagccagaaatggaacaa
ttcatagcgggttttcaacaattttgcggtaagtttgatgcatatggtgagagtggtctc
aagttgcagcaaggcttactcaaattgctcaatatgctcatggatagcacgggagaatta
ctctcagaagatcaatggattggtgttcagataagtaaattgcgtgaaacaatctccagg
ccactggatcatcaggtgatagcacaagctgagcattatctagaagaaataacgcaaaga
caagaaataatcggacgtagtttaagtgaagccaaggtgaccctgaagcagatggtaact
tccttaatcactaatattgaagaacttaccgatacgacgggtgaatatcagaataagctt
gagcaatattctgaaaaaatcagtaatactgatgatataaaagaacttaatcagctgctt
gtgctgattatggaagaaaccagtctgatgcaaaaaagcacattaaattaccgcaatgat
tttttggctgctcgagcagaagttagtttggcgcagaataaaatcaatcagctcgaaacc
gagttacatgaaatgggtgagaaagtgcatgaagatcacctgacaggaatattaaatcgg
cgtggtttagataatgcttttgaccgcgaaacctcgcgttcaatgcgccatcaggttcct
ttatgttttgcactgctggatattgataatttcaaactgcttaatgatacgcatggccat
caagtgggtgacgatgcactagtgtacttggttgagtcagtcaaggagacaacgcgccct
gaagatattgtgtcacgatatggtggtgaagagtttgtaattctattgccaaacacaaat
cttgaagaagctgtacatatcttatccaggatccggcgtaatttaaccaagaagtttttt
ttgcatgaaaataaacgtttgttaatcacttttagtgcgggtgttgctcagctccagccg
ggagaatcacaagaaagtattttcaaacgcgccgatgaagcattgtatcgtgcaaaaaga
ggcggtaagaatcagatactcacatctgtgtaa

DBGET integrated database retrieval system