KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0919Help
Entry
Nit79A3_0919      CDS       T01569                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
nii  Nitrosomonas sp. Is79A3
Brite
Enzymes [BR:nii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Nit79A3_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1007244..1008956
Genome map
AA seq 570 aa AA seqDB search
MKPLKDSNPTIIARETLRQLASLRIPPTPDNYHKLYDQISGNSGDDVNSAAVTSTNQQRI
VDNPTIESAVTWGDTIEALLKQLEKKQGALTTAKKRDGVNRVLAKYSKDSNQLHNKLKAL
VDSWGALAAATQDSNEDGQVQNPSLQVPQVDQDTQGSQLKHAVTEQTPTAGYFADQLLEL
LAHLLEQVVAKQIGDVILVEEARTLAHQVRKIQDKPEMEQFIAGFQQFCGKFDAYGESGL
KLQQGLLKLLNMLMDSTGELLSEDQWIGVQISKLRETISRPLDHQVIAQAEHYLEEITQR
QEIIGRSLSEAKVTLKQMVTSLITNIEELTDTTGEYQNKLEQYSEKISNTDDIKELNQLL
VLIMEETSLMQKSTLNYRNDFLAARAEVSLAQNKINQLETELHEMGEKVHEDHLTGILNR
RGLDNAFDRETSRSMRHQVPLCFALLDIDNFKLLNDTHGHQVGDDALVYLVESVKETTRP
EDIVSRYGGEEFVILLPNTNLEEAVHILSRIRRNLTKKFFLHENKRLLITFSAGVAQLQP
GESQESIFKRADEALYRAKRGGKNQILTSV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcttaaagattcgaatccaaccattattgcccgtgaaacattgcggcagctt
gcatcgctcagaattcctccaacaccagataattatcacaaactgtatgaccagatttca
ggtaattccggagatgatgtgaattccgcggcggtaacatcaacaaatcagcaaagaatt
gttgataatccaacaatagaatccgctgtgacctggggagatacgatagaagcactgttg
aagcaactggaaaagaagcaaggagcgctgaccactgcaaagaaacgggatggcgtcaat
cgagttcttgccaaatactcgaaagattcaaaccaactgcataacaaactcaaggcgctg
gtagattcatggggagcattggctgccgcaacccaagactcaaatgaagatgggcaagtg
caaaatccctcattgcaagtgccgcaggttgatcaggacacacaaggctcccaattaaag
catgctgttacagaacagactccgaccgccggatattttgctgatcagctattggaattg
ctggcacacttgcttgaacaggttgttgctaaacagattggtgacgtaattttggttgaa
gaagccagaacgttagcgcatcaagtgcgcaaaattcaagataagccagaaatggaacaa
ttcatagcgggttttcaacaattttgcggtaagtttgatgcatatggtgagagtggtctc
aagttgcagcaaggcttactcaaattgctcaatatgctcatggatagcacgggagaatta
ctctcagaagatcaatggattggtgttcagataagtaaattgcgtgaaacaatctccagg
ccactggatcatcaggtgatagcacaagctgagcattatctagaagaaataacgcaaaga
caagaaataatcggacgtagtttaagtgaagccaaggtgaccctgaagcagatggtaact
tccttaatcactaatattgaagaacttaccgatacgacgggtgaatatcagaataagctt
gagcaatattctgaaaaaatcagtaatactgatgatataaaagaacttaatcagctgctt
gtgctgattatggaagaaaccagtctgatgcaaaaaagcacattaaattaccgcaatgat
tttttggctgctcgagcagaagttagtttggcgcagaataaaatcaatcagctcgaaacc
gagttacatgaaatgggtgagaaagtgcatgaagatcacctgacaggaatattaaatcgg
cgtggtttagataatgcttttgaccgcgaaacctcgcgttcaatgcgccatcaggttcct
ttatgttttgcactgctggatattgataatttcaaactgcttaatgatacgcatggccat
caagtgggtgacgatgcactagtgtacttggttgagtcagtcaaggagacaacgcgccct
gaagatattgtgtcacgatatggtggtgaagagtttgtaattctattgccaaacacaaat
cttgaagaagctgtacatatcttatccaggatccggcgtaatttaaccaagaagtttttt
ttgcatgaaaataaacgtttgttaatcacttttagtgcgggtgttgctcagctccagccg
ggagaatcacaagaaagtattttcaaacgcgccgatgaagcattgtatcgtgcaaaaaga
ggcggtaagaatcagatactcacatctgtgtaa

DBGET integrated database retrieval system