KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0929Help
Entry
Nit79A3_0929      CDS       T01569                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:nii00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nit79A3_0929
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Nit79A3_0929
Enzymes [BR:nii01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Nit79A3_0929
Two-component system [BR:nii02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Nit79A3_0929
Bacterial motility proteins [BR:nii02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Nit79A3_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1019355..1020434
Genome map
AA seq 359 aa AA seqDB search
MKKIKVLIVDDSALIRKLLSEIIDSQPDMEAIGAAPDPLVAREMIRELNPDVLTLDVEMP
KMDGLDFLEKLMRLRPMPVVMVSTLTEKGSDVTFRALELGAVDFVSKPKIDLATGLKEYG
NEIANKIRIAKSARLRRHAPMPVTKSVSADAVLPAVSNRIASTEKLIIVGASTGGTEAIK
EFLIRMPPDSPGILVTQHMPEGFTKSFANRLNSLCKISVVEAQGGERVLPGHAYIAPGHS
HLLLKRSGANYMTELNQGELVSRHRPSVDVLFRSAANCAGKNAIGVILTGMGKDGAAGMM
EMRKAGAYNFAQDEASCVVFGMPKEAIAAGGVNDIVSLRDMAKSVLSKVSSMGSHGNRI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaaagttttgattgttgatgactctgccttaattcgtaaattattaagt
gaaattattgatagtcagcctgatatggaagctattggtgcagcacccgatcctttggtg
gcacgcgaaatgattcgagagctgaatcctgatgtattgacattggacgttgaaatgcca
aaaatggatggactcgattttctggaaaaattaatgcggttgaggccaatgccggtagta
atggtttcaacactaactgagaaaggttctgatgtaacattccgtgcgcttgagctgggt
gcggttgattttgtttctaagccgaaaattgatcttgcgacaggattgaaagaatatggc
aatgagatcgcaaataaaattcgtattgcaaaatcagcaagactcaggcgacatgcacct
atgccagtcacaaagagtgtttcagcggatgcagttttgccagcagtttcaaatcgtatc
gcttcaactgaaaaattaatcatagtgggtgcttctaccggtggtacggaagcgattaaa
gaatttttaatacgcatgccgcccgactcaccagggattctggttacgcaacatatgccg
gagggattcaccaagtcatttgccaatcgcttaaacagtctttgtaaaatatcggtggtg
gaagcgcaaggtggagaaagagtgttgccagggcatgcatatatcgccccaggacattcg
catttattgctcaagcgtagtggtgcaaattacatgactgaattaaatcaaggtgagctg
gttagtcgacatcggccttcagttgatgtactatttcgatcagcagcgaattgcgctggc
aaaaatgctattggtgtgattctgacaggtatgggtaaggatggtgctgctggaatgatg
gaaatgcgtaaagcgggcgcttataattttgcacaagatgaagcaagctgtgttgttttt
ggaatgcctaaagaagcaattgcagcgggcggagtgaacgatatcgtttcactgagagac
atggccaaatcggtattgtcaaaagtttctagtatgggatcacacggtaatcgtatttag

DBGET integrated database retrieval system