KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1490Help
Entry
Nit79A3_1490      CDS       T01569                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Nit79A3_1490
Enzymes [BR:nii01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Nit79A3_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1589803..1590969
Genome map
AA seq 388 aa AA seqDB search
MKTTIALCFGVFALLMGCTTADTAQESKGEKSVQSLNNSIEAKTLPANKYNLITEDIFDK
AYQSEIVKYWDGYGKNGNFSGIDGVEIKYKTFIRNDEKGAIVISSGRTEGYIKYQELVYD
LGKQGYSIYIMDHRGQGFSGRMTQNKQMGHVKKFDDYVEDLKYFVDNVVKQIPHKNIFLL
GHSMGGGIATLYIEKYPDDFKAAALSSPMHEPGDRLLFINEGCGAVRATRWWRENVFGIS
EPRYVALKGDYSRPACTGSEDDLTHSIVRCTKVADLYENKNFHDVKLGGPSTHWAAEACE
IAVELRSKKETNKIKIPVLVLQAGDDKAVNSDGQNEFCNNLQSNPNKRRCFGDKPQIIPG
AYHELFIEKDEFRIPALTKILDFFVENH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaccatagctttatgtttcggtgtttttgcattacttatgggatgtaccaca
gccgataccgctcaggagtcgaaaggagaaaagtcggttcaaagtctaaacaattcaatc
gaagcaaagacattgcccgctaacaaatacaatctaatcacggaagatatatttgataag
gcttatcagagtgaaatagtgaaatactgggatggttatggtaagaacggcaatttttct
gggatagatggagtggaaataaaatacaagacatttattagaaatgatgaaaaaggagcc
attgtcatttctagcggtcggacggaggggtatatcaaataccaggaattagtatatgac
ctaggcaaacagggttactctatatatataatggatcatcgtggtcagggtttttcggga
aggatgacacagaacaagcaaatgggtcatgtaaaaaaatttgacgattatgtagaggat
ctgaaatatttcgttgacaatgttgtaaaacagattcctcataaaaatatatttttactt
ggacactcgatgggtggtggtattgcaacactttatattgagaaatatcctgacgatttt
aaagcagcggcgctgtcatctccaatgcacgaaccaggagatcgtttgcttttcattaat
gaaggttgtggagcagttcgggcgactcgttggtggagagaaaatgtttttgggattagt
gagcctagatatgtggctctgaaaggtgattacagtagaccagcatgcactggaagtgaa
gacgatttaacacatagcattgtacgttgcacaaaggtcgccgatctttatgaaaataaa
aacttccatgatgtgaaactgggggggccttcaacacattgggctgctgaagcttgtgaa
attgcagtagaattaagatctaagaaagaaactaataaaattaagatacctgtactggtc
ttacaggctggtgatgataaagcagtaaattcggatggccaaaatgagttttgtaataac
ctccaaagcaaccccaataaacgtcgatgttttggtgataaaccgcaaatcattccaggt
gcctaccatgagctttttattgaaaaagacgaatttcgtataccagcattaaccaaaatt
ttggatttctttgtggaaaatcattaa

DBGET integrated database retrieval system