KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1567Help
Entry
Nit79A3_1567      CDS       T01569                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_1567
Enzymes [BR:nii01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Nit79A3_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1666707..1667615
Genome map
AA seq 302 aa AA seqDB search
MTIEQLNTQFGIAGQVEFIAGNGGLPMIQVKTAKARALISIHAGQVLSYQPAGEPEDVMF
LSEKAYYHDGKAIKGGAPICWPWFGADPEGKGRPGHGFVRNRGWNVVATEALSHGDIKVT
VGLDDTPETQAIWPHSFSLRQEIVIGDTLSLSLITRNTGKKKFTITQAFHTYFKVGDIAR
AKVLGLTGCDYLDKAGGGNMQKQQTGDVTIAAEVDRIYLNVGNTLTIDDAALNRRIQITS
QGSKTAVVWNPWEKIARDMADLENDDYKRLLCVETTNAANDVVEVAPSGECRLVADYRVV
RG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaacaactcaacacgcaattcggcatcgcaggccaagtggaatttatcgcg
ggcaacggcggactgccgatgattcaggtgaaaaccgccaaagccagagcactgatctcg
attcatgccggtcaggtgttgtcgtatcagcccgccggtgagccggaagatgtgatgttt
ttgagcgagaaagcgtattaccatgatggtaaagcgatcaaaggcggcgcgccaatctgc
tggccgtggttcggtgccgatcccgaaggcaaaggccgtccggggcatggttttgtgcgc
aaccgcgggtggaatgtggtagccaccgaagcactgagtcatggggatatcaaagtgacc
gttggactggatgatacgccggaaacgcaagccatctggccgcattcgttcagcctgcgg
caagaaatcgtaatcggcgacaccttgagcctgtcattgatcacgcgcaacaccggcaag
aaaaaattcaccatcacgcaagcgtttcatacttacttcaaagtcggcgacattgctcgt
gcaaaagtattgggattgaccggttgcgactatctcgacaaagccggtggcggcaacatg
caaaaacagcaaaccggtgacgtcaccatcgccgccgaagtcgaccgtatctatttgaac
gtcggcaacaccttgaccatcgacgacgcagccctcaaccgccgcattcaaatcacttcg
caaggcagcaaaactgccgtggtgtggaacccctgggagaaaattgccagagatatggcg
gatttggaaaatgacgattacaagcgtttgctgtgcgtggaaaccaccaatgcggcgaac
gatgtggtggaagttgcgccgagtggagaatgtcggttggttgcggattatcgggtggtg
cgtggttaa

DBGET integrated database retrieval system