KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1687Help
Entry
Nit79A3_1687      CDS       T01569                                 

Definition
Succinyl-CoA ligase (ADP-forming) subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:nii01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nii00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nii00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:nii00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1804253..1805428
Genome map
AA seq 391 aa AA seqDB search
MKIHEYQAKEILRKYGVVTPKGIACFSVDEAVKAAQQLGGEVWAVKAQIYAGGRGKGGGV
KVARSLDEVRQRAGEILGMRLVTHQTGPEGQIVHRLFIEQGVHIEKEFYVGMVIDRGRQR
VCLMASSEGGMEIEKVAAETPEKIHKVFIDPIAGLSQQQAEEVALKIGIPAQSVPQAVTL
LQGLYQAFDDTDSSLLEINPLTLTAEKQVIALDAKMNFDDNALFRHPEIVALRDLDEEDP
VEIEASKHELSYIPLDGNIGCLVNGAGLAMATMDIIKLYGGNPANFLDVGGGATAEKVTE
AFKLMLRNPKLQAILVNIFGGIMKCDVIAQGVVAAAREVQLTVPLVVRLEGTNVDLGKKI
LADSGLTIISAENMADAAQKAVSAAKTKSSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgagtatcaggcaaaagagattttgcggaaatatggggttgttacgccg
aaaggcattgcttgtttcagtgttgacgaagccgtgaaagctgcgcagcaactgggtggt
gaggtgtgggcggtgaaggcgcagatttatgccggcgggcgcggtaagggcggtggggtg
aaagttgctaggtcgttggatgaggtgcggcaacgtgcgggggagattctgggcatgcgg
ctagtgacgcatcagaccggcccggaagggcagatcgtgcatcggctttttatcgaacag
ggtgttcatatcgagaaagaattttatgttggcatggtgatcgaccgcggccgtcagcgc
gtgtgcctgatggcaagttcggaaggcggcatggagatcgaaaaagtcgcggctgaaacg
ccggagaaaattcataaagtgtttattgatccgattgcggggctcagtcagcagcaagcc
gaggaagttgcattaaaaatcggcattcctgcgcaaagtgtgccgcaagcggttacgttg
ttgcaaggtctgtaccaggcttttgatgacaccgattcgtcgttgctggaaattaatccg
ctaacgttaactgctgagaaacaggtgattgcgctcgatgccaaaatgaattttgacgac
aatgccttgtttcgtcatccggagattgtcgcgctgcgcgatctggatgaggaagacccg
gttgagattgaggcatccaaacacgagttatcgtacattccattggatggcaatatcggc
tgcctggtgaatggtgcgggactggcgatggcaacgatggatatcattaaattgtacggc
ggcaatcctgcgaatttcctcgatgtcggcggcggcgcgacggcggagaaggtgaccgag
gcgtttaagttgatgctgcgtaatcccaagttgcaagcgattctggtgaatattttcggc
ggcatcatgaaatgcgatgtgattgcgcaaggtgtggtggcagcagcgcgcgaggtgcag
ttgaccgtgccgttagtggtgcgcctggagggcaccaatgtggatctcgggaaaaagatt
ctcgccgattccggtttgacgatcatctcggcggaaaacatggccgatgcagcgcagaaa
gcagtcagcgcggccaaaaccaagtcatcgtcgtga

DBGET integrated database retrieval system