KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1687Help
Entry
Nit79A3_1687      CDS       T01569                                 

Definition
(RefSeq) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nit79A3_1687
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nit79A3_1687
   00640 Propanoate metabolism
    Nit79A3_1687
   00660 C5-Branched dibasic acid metabolism
    Nit79A3_1687
Enzymes [BR:nii01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nit79A3_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1804253..1805428
Genome map
AA seq 391 aa AA seqDB search
MKIHEYQAKEILRKYGVVTPKGIACFSVDEAVKAAQQLGGEVWAVKAQIYAGGRGKGGGV
KVARSLDEVRQRAGEILGMRLVTHQTGPEGQIVHRLFIEQGVHIEKEFYVGMVIDRGRQR
VCLMASSEGGMEIEKVAAETPEKIHKVFIDPIAGLSQQQAEEVALKIGIPAQSVPQAVTL
LQGLYQAFDDTDSSLLEINPLTLTAEKQVIALDAKMNFDDNALFRHPEIVALRDLDEEDP
VEIEASKHELSYIPLDGNIGCLVNGAGLAMATMDIIKLYGGNPANFLDVGGGATAEKVTE
AFKLMLRNPKLQAILVNIFGGIMKCDVIAQGVVAAAREVQLTVPLVVRLEGTNVDLGKKI
LADSGLTIISAENMADAAQKAVSAAKTKSSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgagtatcaggcaaaagagattttgcggaaatatggggttgttacgccg
aaaggcattgcttgtttcagtgttgacgaagccgtgaaagctgcgcagcaactgggtggt
gaggtgtgggcggtgaaggcgcagatttatgccggcgggcgcggtaagggcggtggggtg
aaagttgctaggtcgttggatgaggtgcggcaacgtgcgggggagattctgggcatgcgg
ctagtgacgcatcagaccggcccggaagggcagatcgtgcatcggctttttatcgaacag
ggtgttcatatcgagaaagaattttatgttggcatggtgatcgaccgcggccgtcagcgc
gtgtgcctgatggcaagttcggaaggcggcatggagatcgaaaaagtcgcggctgaaacg
ccggagaaaattcataaagtgtttattgatccgattgcggggctcagtcagcagcaagcc
gaggaagttgcattaaaaatcggcattcctgcgcaaagtgtgccgcaagcggttacgttg
ttgcaaggtctgtaccaggcttttgatgacaccgattcgtcgttgctggaaattaatccg
ctaacgttaactgctgagaaacaggtgattgcgctcgatgccaaaatgaattttgacgac
aatgccttgtttcgtcatccggagattgtcgcgctgcgcgatctggatgaggaagacccg
gttgagattgaggcatccaaacacgagttatcgtacattccattggatggcaatatcggc
tgcctggtgaatggtgcgggactggcgatggcaacgatggatatcattaaattgtacggc
ggcaatcctgcgaatttcctcgatgtcggcggcggcgcgacggcggagaaggtgaccgag
gcgtttaagttgatgctgcgtaatcccaagttgcaagcgattctggtgaatattttcggc
ggcatcatgaaatgcgatgtgattgcgcaaggtgtggtggcagcagcgcgcgaggtgcag
ttgaccgtgccgttagtggtgcgcctggagggcaccaatgtggatctcgggaaaaagatt
ctcgccgattccggtttgacgatcatctcggcggaaaacatggccgatgcagcgcagaaa
gcagtcagcgcggccaaaaccaagtcatcgtcgtga

DBGET integrated database retrieval system