KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1790Help
Entry
Nit79A3_1790      CDS       T01569                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nit79A3_1790
   00670 One carbon pool by folate
    Nit79A3_1790
Enzymes [BR:nii01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Nit79A3_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1920547..1921065)
Genome map
AA seq 172 aa AA seqDB search
MTTPRLSLLVAMARNRVIGRNNKLPWHLPADLKHFKFLTMGQTIVMGRKTYESIGRPLPG
RANIIVTHQTGYEVPGAIVVNTIDDALLICERTKSINGENFIIGGEELYRQTLKICQRIY
ITEIQRDFEGDVFFPEFDPNEWEETQRDRHISENDTNLEYHFVVLDRKVNAT
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacctcgtttatccctactggtagctatggcgagaaaccgggtgatcggcagg
aataataaattgccgtggcatttgccagccgatttaaagcatttcaagtttctgacgatg
ggacaaaccattgtgatgggacgtaaaacatatgagtctattggtagacctctgcccggc
agagcgaatattattgtcacgcatcaaacaggatatgaagtgccgggagcgattgtggtt
aacaccattgacgatgcgcttctgatctgcgaaagaaccaaatcgatcaatggtgagaat
tttatcattgggggcgaagaactttaccggcaaacccttaagatttgtcagcgcatttat
atcacggagattcagagagattttgagggagatgttttctttcctgagtttgatcctaac
gagtgggaagaaacgcaacgcgataggcatatttcagaaaacgacaccaatctggaatac
cattttgtcgtccttgatcgtaaagtaaatgcgacttaa

DBGET integrated database retrieval system