KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1805Help
Entry
Nit79A3_1805      CDS       T01569                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
nii  Nitrosomonas sp. Is79A3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1935241..1937142)
Genome map
AA seq 633 aa AA seqDB search
MNESKNSNPSFIARETLKQLALLKVSPTPDNYHKLYDQIAGNPPNQISAITAKMLTDLAK
ELPRHTPQLLNFANNLEQAANERNWIKFKSVMIKLVTNETEPVNKHTILVNSISEPDIPW
GGTIEELFNLLPAKNQTLICDRKWQDLHQVLIKFSKDSDQLHNELRRLIDSWCALASNPQ
EMIANGEGFSLVESDPKNSHPEYIASEQKDVISNFTGQMLELLAQMLEHIAVTLLDDAAL
TNEARTLAQQVRKIQDKQEMEQFVANFQKFCVKFESHGESGIKLQQGLLKLLNLLMDSTG
ELLSEDQWIKEQISRLKETISRPLNLQIMAQAEQYLKEIIHKQEIIKQSLGKARVTVKQM
VNSLIHNIEELTDATGTYQVKLEYFSDKVNQTNDLEELNQLLVEIMQETKQVQSSVLEYR
DDLIVTRAEVSKAQDQISQLEIKLLEMAEKVQEDHLTGTFNRRGLDSAFEREISRAQRNQ
EPLCFVLLDIDNFKQLNDTHGHKVGDDALVFLVGAIKETTRPEDIVSRYGGEEFAILLPN
TVLEEALLISSRILRNLTKKFFLYENKRLLITFSAGVAQYQVGESQESIFKRADQAMYKA
KKTGKNQILAADNLHSSIVHPQEKNASSVNCTC
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaagtaaaaattctaacccttcttttatagcgcgtgaaacgttaaagcaactt
gcgttgcttaaagtctcgcctacaccggataattaccataagctatacgatcaaattgcg
ggtaatccacctaatcaaatatctgctattaccgcaaaaatgctaactgatttagccaaa
gaacttccacgccatacaccgcaattgcttaactttgccaataatcttgaacaggctgca
aatgagagaaattggataaaatttaaatcggtaatgattaagcttgttacaaatgagact
gaacctgtaaataagcatacaatcttggtgaattcaatatcggaaccggatattccgtgg
ggaggaacaattgaagaattatttaatctcttaccagctaaaaaccaaacattgatttgt
gatagaaaatggcaagaccttcatcaagttcttatcaagttttcaaaagactcggatcaa
ttacataatgaattaagaaggcttattgattcatggtgcgcattggcatcgaatcctcaa
gaaatgatagcgaatggtgaaggcttctcgcttgttgaatctgatccaaaaaattctcat
ccagagtatattgcctcagaacaaaaggatgtgatcagtaattttactggccaaatgctg
gagctattggcacaaatgcttgaacatatcgcggtgaccctgcttgatgatgctgcgcta
accaatgaagctagaacattggcacaacaagtacggaaaattcaagataaacaggaaatg
gagcaatttgttgctaattttcagaagttttgtgtcaaattcgaatcgcatggtgagagt
gggatcaagttgcaacagggtttgctcaaattgctaaatttattaatggacagtaccggt
gaattgttatctgaggatcagtggattaaggagcaaatctctaggttaaaagagaccata
tctaggccactgaatttgcaaataatggctcaagcagagcagtatctaaaagaaatcatt
cacaagcaagaaatcataaagcaaagcttaggcaaagctagggttactgtgaagcagatg
gtgaattccctcatccataatattgaagaactcactgatgcaacgggaacataccaagtt
aagctagaatatttttcagataaagttaatcagactaatgatctagaagaactgaatcaa
ttgctcgtggaaattatgcaagaaactaaacaagtacaaagcagcgtcttagaatatcgt
gatgatttaattgttactcgggcagaagtgagcaaagcacaagatcaaatcagtcaactt
gaaattaagttattggaaatggcggagaaggtacaagaggatcacctcacaggtacattt
aaccgacgcggtttggatagcgcatttgaacgtgaaatatcacgcgcacagcgtaatcaa
gaacccctatgttttgtgttgttagatattgataatttcaagcaactaaatgatacacat
ggacataaagtaggcgatgatgctctggttttcctggtcggtgctatcaaagaaacaaca
cgaccagaagatattgtgtcgcgctatggtggcgaagagtttgcaatactacttccaaat
acggtgcttgaagaagcactcttgatttcatcaagaatactccgcaatttaactaagaaa
ttctttttgtacgaaaataaacgcttgttaattacttttagcgctggcgttgcgcagtat
caagtaggggaatcgcaagagagtatttttaagcgcgcagatcaagcaatgtataaagca
aagaagactggaaaaaatcagatacttgcggcggataatttgcattctagcatagtgcat
ccgcaagaaaaaaatgcttcatcagtaaattgcacttgctaa

DBGET integrated database retrieval system