KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1881Help
Entry
Nit79A3_1881      CDS       T01569                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nii00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2006607..2007392)
Genome map
AA seq 261 aa AA seqDB search
MSNKTFNLDKEQLIKQSLVQMDTHLQGTNYTQAQKLALTCRILFENGHDSGLAGQITARG
EKPGTYLTQRLGMGFDEICASNLLLVNEDLEVLQGDGMANPANRFHSWLYRARPDVQCII
HTHAVHTAALSMLEVPLEISHMDNCVLYDDVAFLPKWPGIPVGNEEGEMISKAIGSKRAL
LLAHHGLLVAASNIEEACILSIAFERAARMHLLAAAAGKIQPIDPKLGREAHDWILRGQR
NTVGFAYYARRSLKKNTDCLE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataagacttttaatctagataaagaacagttgatcaagcaatccttggttcag
atggatacgcatctccaagggacaaattacacgcaggcgcaaaaattggcactgacctgc
cgtattttgtttgaaaatgggcatgattcgggattggcaggacaaatcacggcgcgaggc
gagaaaccgggaacatatttaacccaacggctgggcatgggttttgacgaaatttgcgcg
agtaatcttttgctcgttaatgaagatctggaagttctgcaaggcgatggcatggcaaat
ccggccaatcgttttcattcatggctgtatcgcgccagacctgatgtgcaatgcattatt
catacgcacgccgtgcataccgccgcccttagtatgttggaggtgccgctggaaatatcg
cacatggataactgcgtattatatgacgacgtagctttcttgcctaagtggccgggtata
ccggtaggaaacgaagagggcgagatgatttccaaagccattggcagcaagcgcgccttg
ttgttagcgcatcatggcttgctggttgccgcttcgaacattgaagaagcctgtatttta
tccattgcattcgaaagggcggcccgcatgcatttactggccgctgcggcgggcaagatt
cagccgattgatcctaaattaggccgggaagctcacgattggattcttcgcgggcagcga
aacaccgtaggttttgcgtattatgcacgccgcagtctgaaaaagaatactgattgcctg
gaatga

DBGET integrated database retrieval system