KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1888Help
Entry
Nit79A3_1888      CDS       T01569                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_1888
   00030 Pentose phosphate pathway
    Nit79A3_1888
   00051 Fructose and mannose metabolism
    Nit79A3_1888
   00052 Galactose metabolism
    Nit79A3_1888
   00500 Starch and sucrose metabolism
    Nit79A3_1888
   00520 Amino sugar and nucleotide sugar metabolism
    Nit79A3_1888
  Nucleotide metabolism
   00230 Purine metabolism
    Nit79A3_1888
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nit79A3_1888
Enzymes [BR:nii01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Nit79A3_1888
    5.4.2.8  phosphomannomutase
     Nit79A3_1888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2012867..2014243
Genome map
AA seq 458 aa AA seqDB search
MNVIPHEIFKAYDIRGIVGKTITADNVEKIGHAIGSEARARKLTAIAIGRDGRLSGTELS
QALARGIRKSGIHVVDVGMVATPMLYYAAHELCQYSGVMVTGSHNPPEYNGFKIVLGGQT
LAAETIQALRLRIENNDLTHGAGDYSEHAIVNTYIERITGDIKLTRPIKIVVDCGNGVAG
AFAPALYRGLGCEVIELFCEVDGSFPNHHPDPSVPDNLKDVVQALKTTDAEIGLAFDGDG
DRLGIVTKDGHIINADRQLMLFAADVLSRNPGGKIIFDVKCTRNLAPWISQHGGVPVMWK
TGHSFIKAKLIESKALLAGEMSGHLFFKERWYGFDDGLYAGARLLELLSREADINATLDN
LPDSINTPELQVRVAEGENHTLIAQLQKNAVFTNPQQVITIDGLRVEYNDGFGLARASNT
TPVIVLRFEADNEIALKRIQEDFRHNILQAKPDAQLPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaattcctcatgaaatttttaaggcgtatgacattcgcggcattgttggcaaa
acaatcactgctgataatgttgagaaaataggccatgcgattggttccgaagcgcgtgca
agaaaactgacagcgatcgccatcggccgtgatggcagattatctggaactgaattatcg
caagcgcttgcgcgtggcatccggaaaagcggaattcatgtggtggatgtcggcatggtc
gcgacgccaatgctttactatgccgcacatgaattgtgtcaatattccggggtgatggtt
accggcagccataatccgcccgagtacaatggctttaaaattgtattaggcgggcagact
ttagctgcggagaccattcaggcattgcgtttacgcatcgaaaataatgatctcactcat
ggtgcaggtgattattccgaacatgctatcgtcaatacgtatattgaacgcatcactggc
gatatcaaactcactcgcccgatcaaaatcgttgttgattgtggcaatggtgtagcgggc
gcatttgcaccggcactctatcgcggcttgggttgtgaggtgattgaattattctgcgag
gtggatggttcttttcccaatcatcatcccgatccatcagtgcccgataatctgaaggat
gtcgttcaggcgttgaaaaccaccgacgcagaaattggactggcttttgatggcgatggt
gaccggcttggtatcgttaccaaggatggccatattattaatgctgaccgtcagctcatg
ctgtttgcagccgacgtgctctcgcgcaacccaggcggcaaaatcatttttgatgtgaaa
tgtactcggaatctggcaccctggatcagtcagcatggcggcgtgccggtcatgtggaaa
accggtcattcattcatcaaagcaaaactcattgagtcgaaggcattattagctggagaa
atgagcggtcatttatttttcaaggaacgctggtacggttttgatgatggcttatatgcc
ggcgcccgattactggagctactgagccgtgaagcggacattaatgccacgctggataat
cttcctgatagtattaacacaccggaacttcaggttcgtgttgccgaaggtgaaaatcat
acgctgattgcacagctacaaaaaaatgcagttttcactaatccacagcaagttatcact
attgatggtttacgggttgaatacaatgatgggtttggtctggcgcgtgcttctaatact
acgccggtcatcgtattacgctttgaagctgataatgaaatcgctctaaaacgcatccaa
gaagacttccgtcataatattttacaagccaaaccggatgcgcagctgcccttctag

DBGET integrated database retrieval system